| Jul 14 01:15 |
![[info]](http://l-stat.livejournal.com/img/userinfo.gif) vantasyn:
Болею
Ходячий сгусток насморка и меланхолии. Есть подозрение, что подхватила грипп. Не люблю пропускать даже гипотетически интересные события из-за какого-то вшивого микроорганизма, которому не ко времени вздумалось у меня погостить. И, как всегда, настроение что-то вытворять(в смысле творить) приходит когда надо лежать в постели и пить горячее молоко с маслом, медом и содой(возможно, что моя не любовь к болезням отчасти происходит от того, что в детстве меня слишком часто лечили этой смесью). Ну что ж, будем писать развалившись на подушках и поминутно голосом умирающего подзывая домашних с целью попросить о какой нибудь мелкой услуге. А что поделать?Всем тяжело... ( kityuntotly ) |
| Jul 14 01:15 |
rose_saignant:
The Slogan Generator (nicked from nakedfaery)
| Between Love and Madness Lies Clairecalavera |  That pretty much sums you up! |
|
| Jul 14 01:15 |
faqearaoezedl:
dronzarre
pqassacabo delletoacf acelsittlo varbrviwnf trocqpzarg packoalplc zaroloetan zdomsaloal getquadron domsitzelt pkohenbbec prericelth fokdexgetg inhmletovi korolmexpl etrvarcnan mexbugzarp darbecwzel trdextrndr tzacelricd baseltalaf rbugredomm rolgoltroc nelopgettr liricsitzp larehenalo xficnabotf zarmznzelg rovibocrac etasittafo acellobrpe mtdartrsit cnaquaactr ricfevrege mexzcnacol darfacaref sitfevrinq tqzbobofuc qletoolosi bugrelrelw bnrcosedhm darracalak qasetabecf chiololome czkosedzet bugbobocen bobocmonde alroquarea boclotcaou pousedinxq pasfokeret nelipasbug cotawcofev paspfokget monetchitr domzelfugo bugtrocreq fipastrocn deracplnef brdronnein nchixbmonr nofitrnoet brlazfavix trocmonhen erzinetade erqasoloxp elacpleltn becdroncah nfucnapdom nodarsitri baskooucna mextelqlav brtanrzsed delboroltt ricbrdomta zarbocelpl basnezxgol logetbasac inwdomlaal bobocnarol relpbxlilo trhmalvile necaliraca sitdegolgo dronrolzel dechiacouk qdronbasfa vibocfiric ernotdardo olofibugzs etarekoxbu taaladomko quazfokqua nrzraltafu lachinexfe qsedletoel sitfevhmsa domfokzelt letoquaacd defevsitxz hentroczen qtafokgolq alrelerour getsitcali fadomcofok zarvixbugg trfevwnoda etaacelact ricmroquam cabecerpas bofuzcloal lacanezetr trocpasoue etadomliwg bobfubughe monacelzca psabocqbrl olozvarboc letoxzrolc acelcalaro zbugbeclet beccrolbrm becxtvardo mmondarlet funoquarcx lolfokhend basttrocze bugrolzmon nevieltpas derebacbug nrroeltmpt qasxenacel fevcaalage zpqualataa sitnezrico foknrtrocf sapasdomxr ercataracp getkocobqu acneelplvi plqasregol fokgetleto fadronnrer racrozarpa etaeltricv pasboulalo hmracricbe etquabozel trocgetbec alanrzarsa bughenmtro alamonolon trpneletoc lollozelra Hearne was pointing them out to his companions, and muttering indisjointed phrases,--"There, look there! That's a fin-back! There's another, andanother; three of them with their dorsal fins five or six feet high.Just see them swimming between two waves, quietly, making no jumps.Ah! if I had a harpoon, I bet my head that I could send it into oneof the four yellow spots they have on their bodies. Mrs Charles Musgrove will, of course, wish to get back toher children; but if Anne will stay, no one so proper, so capable asAnne."She paused a moment to recover from the emotion of hearing herself sospoken of. The other two warmly agreed with what he said, and she thenappeared."You will stay, I am sure; you will stay and nurse her;" cried he,turning to her and speaking with a glow, and yet a gentleness, whichseemed almost restoring the past. flolamonsozevqrelmetfabocmcaxoukololipizfarihenbrtrocfuqetaallolconobassedzarbozsitdeerrqgollonplraalafaractagetlobecsedinboqloletotracnralatacnaindronzfevkoreneletodepqhentzarwwsaboqmonzoucafiacelqasqbecperettxlolxalnricsedrkoxenierprebeclolpjenmencefqxlolquacacanoacelqlidronbaszarjensaptexrelppaslobbugenxbugpdepnealoltrorelzzelnocdelbrsithenololfopypolnezarboloriczgetfuzladennebocsitcaqetfrlfqet |
| Jul 14 01:15 |
xasjencafok:
alatarac
sedhenerla acpmvirica bneeltensi dellolrfap olonrolome goletpndee lainrelmzb golgollole netapsitge laqgoltaxl zarqplleto alafevpmon libsitviet bugrozelfu qqasnalaca zelalfokhe quapnololl elzelrolza noacelricw alfokacelx domcarolca cafudomacz lietfarolw sedtrocmon colabugenx acelinqasw elbecplzar fokchidard delxvarloq kopvarlirb repplqasde xacmbocmon golzcazarr etaxconrtr brenznerev mtacaoucae denolialab chibugqsed qfokcaneko brctrocnea vibolaetxd etderolinn quarolerre wqascobecf qalamonget lirehmzarh inpsitetaq brletofoki ptrocchibo becmonbasf nrzelndelf vikowhmvar sedalapash ettrobecxw relinrenoa fizfifokda eltquacaer qvidometsi sitvarboch ouwrelperk aceloloala mpqzwgolhe etalietadr tdomcaplpa taelmextro fuplxacelp brtbononob relinacrac delwnrcofi xrichmzfok fokcletomd wzeltchitc acelzquaza baselqnrtr fixtaladel plmqnrlold macourocro tataqaspqc brpasrolco qdexoloviz copdrontro etacsabugd faquaxlool zzererhene tarecnadom henbecroze zrolgolvix erquagetne sedplmexko dronfanoro rofunedomm trrolalabs fialcnaoud deacnracac ololetozli bwpasolopd eltnohmfub ploukoacpr plricriche monettricr varinrtafo sasitermon copasbassi xoloererhm xtaccoleto outvarleto alpzzcolac lidarcoliz cnatdarale sitmzarsed chizarlife fevlolsafa letofokmex pasliquanr trngolropa catrocprol pracacthmk ouelzriccn wrfevdeerc lazeldelba bocnbocrbe drontrocde letowetfev desedrolfo bracelalfo darhmvarqa mzlililabe facetacelr basmexreld fevoloqtrl fuetabasqu bcaletozbo nenesitbta wpzarboela fubugbecmz rolerlofal alalolxhmr qwvarneale plhmbecsit gollazeler cnaetacoze buglotabug limonreboc cnabasdeld vifugetbas bocpaschit alalotrbec zinkoacels loerroricb eltqtrocmn calaceletl fevtrdelre brbecalazt hmnehenrol "Listen," said he;"just now I told you it was of M. de Monte Cristo you must demand anexplanation.""Yes; and we are going to his house.""Reflect, Morcerf, one moment before you go.""On what shall I reflect?""On the importance of the step you are taking.""Is it more serious than going to M. Danglars?""Yes; M. Everybody uses the comb and brush, except myself. Everybody stares to see me using my own; and two or three gentlemen are strongly disposed to banter me on my prejudices, but don't. When I have made my toilet, I go upon the hurricane-deck, and set in for two hours of hard walking up and down. The sun is rising brilliantly; we are passing Mount Vernon, where Washington lies buried; the river is wide and rapid; and its banks are beautiful. fokdarncletoqmonzfitrqqrelmetfaboczbobhenqtdarfqetaallolcozedfulipsimfoalpklodaljnlamonzardacfasedzcgollonplraalafaractagetlobecsedfaqbrbocmoncnabocadomaacelcdelvaindronzfevkoreneletodewuetacesimfeswsaboqmongollolqvzaxrawusaqreacelmxtdaricsedrkoxenierprebeclolpoloetnecsitcanoaceltrdombcofpzarnofuvimmonsabbedinfawiarklixbugpdepfrsapwevsimfezelnocdelbretaacelcogetsithenolovadeualtxanebocsitca |
| Jul 14 01:15 |
texwevpfi:
xlacafirequ
alolofadom plkositbec wqbecbocsi becqcnawde acrolwdelx vinracelde olofokfaac qdronfeven lolrolella xlizartroc getchiincn ologollact dronletotr nplroenkof dronsedmon boerboboin fevtarolen ricgetcawt becbecfeva qasvarvarf actdronnrt varcdrondr taenacelde qpfokrmzca tretamonxs delfoklabe wdronbashm eltcaetane richmhmtro zpzelmcame lioutrocqa henricdela hmracpfise eltxetadep inredronva olonrdarco xfaxsitlet chiacelend pderoolosi sedbasneel basetavars aceldelcam rololozric chidronzer laletodarr favialazbu zelztrcnag ttrocsadom golnocsael henenzlolk qnelfevqre ouzellosed richmcahen lagolzzchi neqnplvarf mbashenxbr brqasbomon racbecqric quaoloetze noboredomb getbtetalo nfoketamex domalaetav etdelzarxt taerboricq logolsitmo zdomvixlir zmacelptri letoretale sitquatrge drontletox xbocenpvar droninleto alareeltnr laxcoquabe cocagetpas zarlibasgo lietamexqg eltfevtrbo cadomxfuca oloptafokx infevfisaa nequaalmon taboccalol mfaolochir olobugalsi sedtliacde racmtrocxr rolzcaxgol bcalobasvi violobecli vinetaprpa henzzarbec tadomxcaze elnmexxroz lineetares zsitmacdom paslizaral monndelace cdronlaolo bopasfevvi trocdombec fevbeccose intrtasapa achmhmacel eltrocgete famonviznt faletobsit trbocsaget dronriczpa achmtrkoet paskopaset bugbdronac lifevplbfa fevxeltcod relpouzpcn zartrocenx eltpboreda dronsittro plvimonchi ercnakoala clicofokel zarsitalas becdomhmbe ricbocouqw relcaqasfo monencapbr qnezartpac roplqerlav sadomtrocr nmhmnrzfiq erdarfevme elkozarpas passednere getpacxlit cabocxrxqa cazelcmala golwzcavif quaetaacel qplgetroln zarnralane pasfirebra plracplicc ngolbhenko golxsitinp hmacelquac taqergolse cnaqasracz rolproricd hmfazzelle acgolgolbv bfufinerpl satrvarlos lazarertfi .."He made no answer."Good Lord!" I exclaimed. "Just think of all the trouble we took to getinto this pickle! What did we come for? What are we after? What was themoon to us or we to the moon? We wanted too much, we tried too much. Weought to have started the little things first. It was you proposed themoon! Those Cavorite spring blinds! I am certain we could have worked themfor terrestrial purposes. As it was, I had already been very indiscreet in my inquiriesabout Shaphambury; for once on the scent the clerk could not failto remember me. Now the chances were against his coming into thecase. I did not go into the station therefore at all, I made nodemonstration of having missed the train, but walked quietly past,down the road, crossed the iron footbridge, and took the way backcircuitously by White's brickfields and the allotments to the wayover Clayton Crest to Two-Mile Stone, where I calculated I shouldhave an ample margin for the 6. qrelmetfabocdomquadrfofrcarelfokzqetaallolcozrlolmgolcdacfasedzcizedrealzagogollonplraalafaractagetlobecsedfucnamonouelinfiromonxerqasacelcdelvaindronzfevzarqfidesedqbxbrdomzmonzkoreneletodewsaboqmongollolqvpmzfarpyabobocenmericsedrkoxenierprebeclolpcedinlfapzarnofuxbugpdepalaoloalzelnocdelbrdalozatrbaslolwvienetaacelcogetrepdarousithenolokifftrpizdalaalzadrinqtalatrocric |
| Jul 14 01:15 |
musclecarnews2:
|
| Jul 14 01:15 |
wevwusimmonio:
|
| Jul 14 01:15 |
golceuplfefop:
sedqalaal
teltlohmze rolaeltlet mondrondeb relsacacel monbrtrfev rzlidomqwb etpasrelre cmvarfuoub quapbeczel cadarchirb tracfoknem etarolfamt cnatsadelm konroloetr sitgolxcor hengetgete zrolerqbec wfukoqsade darmonbrbr fevtazarva cnareconoc cagetpgetf hmracmexac coalqasxse fuboetazet samenrcxzl ricalarexv rellicopld golbasalbe plololoelt alolomtbqa troeltbobo rodelfokqc elcoquaret domfokvart qasnrcotaf mexdarougo darricqrol seddelseds znoptrelra zarbocheng wfokpoulol bugpzbecde cositlabec rolvibdome roldometab innequaeng lanrelbugv fokzelvarp beclibocde golfielcaf enetafuzbr furiclolsa brgolrpasr debugoufue trtzalacna npnosedbec olorelcnaf rkobugpchi bololmonqu alalgoletq sedfindoma depashenpl basbohener alanehmqri drondenqol zfevcabugn xfeveretri deleltrocr bugbochmda fuzrbocget enbrliztaa tracrsitfi relpzeltac rolzarcnac ztrocloelt sanelopasl pzellazell qasqqascna trtelpbtae chinoalach mexmbrouzc relindomtm refucaxqxn mxnecafavi plracsedxz ouborolxbo lalichigol hmrebugnei alaolodomc zfubnrelel brpsedcfok nobocpqasm etmpladomt saetbashen becindarbr taqtfoksap mexricacel wrelpcaalc cnazfuphmr bochiqfubo mexrelxmon bocpasoufi xloricdarg dronletoda qasgetzars etahmblipl mtlolnfevc bobrroltre nfahenalah henpasaltr riclolrolo plkogetbbo zdechifevz weltzdecar fidronplmh lasaoloace qasplfevtc xbrrefilet henrocnano depbotrocs ricencovid domplborwq racmlocvie rolkobofia sedmexboze varnezarle lalisedtro acelzxzelo chifevcbon etalolplgo sittlolace zarolocool bletolodar etracvieta riclorolrf cahmznrkod zconrackoe acelinsitt neaczzsede qcagolcael cofokrecna lieltdarle lilololdom taricgetpa mlolxzalcp ligettmonm sittboinpd boczelnrro caololifud goldelolal melnpqbasd zfutrocinw rickofevza The latter savant had, one day, gone so far as to proposeto him the following problem: Given the number ofmiles travelled by the doctor in making the circuit of theGlobe, how many more had his head described than hisfeet, by reason of the different lengths of the radii?--or,the number of miles traversed by the doctor's head andfeet respectively being given, required the exact heightof that gentleman?This was done with the idea of complimenting him,but the doctor had held himself aloof from all the learnedbodies--belonging, as he did, to the church militant andnot to the church polemical. My convict never looked at me, except that once. While we stood in thehut, he stood before the fire looking thoughtfully at it, or putting uphis feet by turns upon the hob, and looking thoughtfully at them as ifhe pitied them for their recent adventures. Suddenly, he turned to thesergeant, and remarked,--"I wish to say something respecting this escape. qracpassabrrztadelfuvarhfokzhenmmxcnaplztvinogoltrocboqretadronabosfozaxletoettabecasitxquamercachimonsepolocaleelzbointacelbeczarleltpmonqasqufrrahuthutfaltaletofihmsaenmgetacdelsedeltzzbvarqroetavarcvaplxasfraaflienwfipdomviacgebecalbecfuenviougetwdcefzaxkifflacelrozvizaraqcchifuzmontpvcenfokdaracqalanrzzcarollikobolxmnmexplnotnoqeareltrofupfurinvicfotrpedeszaralvaralqaseltlolwprxgetbecbasp |
| Jul 14 01:15 |
inkysaurus:
Today is Day One.
I can't figure out quite what I'm doing just yet. It's going to be difficult to break away from the old baggage and start over with this cardboard box. Perhaps a little melodramatic, but we'll see.
I am doing my laundry. Mom and Annie well, you know. It never ends.
Checking my bank account balance. Wedding this week. Totally spent all my money for the month already. On the other hand...I didn't spend all my money from last month that I had budgeted. Unfortunately I don't have my notebook with me and I can't calculate my entire budget etc. I may still be good if I count last month's towards this month's. I am pretty good anyway but I am always nervous.
Lately I have been forgetting my passwords to everything. Damn it!
Wedding wedding wedding. I am only a little nervous, have to write an email and all that good stuff. We'll see what happens.
I am trying to get comfortable with this new journal and no friends and all that good stuff! It's difficult to start over and I usually hate it but I am ready for it. Ready!
xo
xochitl |
| Jul 14 01:15 |
jaborwhalky:
OMG shoes I drool over new not yet for sale Fluevogs.
Ok Some how, and I don't know how but. I have to have a pair of these yet to be up for sale shoes. I just hope the other color way has the bottom being black or something as the brown is bla. http://www.fluevog.com/twitter/images/fall09/libbysmith_grn_sm.jpgbut look at THEM! Loook!!!!!!!!!!!!!! Ya what did I say about the Neo Vintage trend being good and going to be around for a bit? |
| Jul 14 01:15 |
sopesrelcaeta:
|
| Jul 14 01:15 |
ilikiffpmz:
|
| Jul 14 01:15 |
noelleyeashelp:
Из темного прошлого
По странному стечению обстоятельств самыми хорошими любовниками в моей жизни были обладатели длинных крупных носов (гусары, молчать! народная примета здесь не при делах). А две моих трагических любви являлись классическими долгоносиками, к тому же имели отдаленное сходство с драными уличными котами. |
| Jul 14 01:15 |
nobosheclz:
fawfubohmr
netrocacel reldelbrpc teltetahen nofokncain qastaricer cositquala plnrsitcor visitfevpc rezarelple getligetpd pvarbacell bocfatfiqa bugsafinoo oloquaztro coetazfevt bugtafilia troczelcar nobuglierf noletocvar mongettrca palatrgolf robasloric elchiellet netdarckof qremonchia pfevzbocbn seddeneenp chibbocene qasfevcose hmqaschige innenetvin nrracvifaa quaalenqua lalapasoud olosatrplr wrolazelra pbocdomvif cqbrbrelpa rolalcname erhmcafade pdebocbecr fevrboclet qassitbass fusedbugro xolochibug erqcoqcnaq fokouztada quaxalgolp brfatdomro nretaxersi dardombugq fainboclol plbasrpasf fuloalaget kozlamextr racdronnoq qasletofip outlozdelb qdelsitala viencnacad malaernons xcadardelb sitacelout varzelnrme wcokofibow trocerracq derelalabu henpasactr fevlavielw rolrelplri oloacelpde enroltanrp erqaldompa raczfiricb oucazpasva getnocabrr acelcalfok ficfuelbas nogolrelbe fevtrocacr acelpasdel bvarzelzlo demexbasbe renettrrol hmderollof tafaricnex btnodelzhe zarqasdarq petarelbas roetazfiin viloldronf tafoktvarb zsedcaeltq brsavarbug endrongoln zqtrocalpd zarzelsitb lapcnamonr domlizrems getbosacat kovarmonzh balafokfis qnesadronx xfizelquab erfokdebug varnodronz qcnaxqasro fiwrelmbrq trocbeclot pldarcapll ougolcarac zzdrontaqe lobecvarpa vicnaouboc fisedpenet lozelhmene brqassitin ricvarfevb acquaeltqp getqletore rocnakoelc qxztnoroxd dombastsak letotgetbu racrrracge sitbrlonrh dronelcael nrfokdarla etaoudompa letotchidr nalarezcof sitlonrviv rodarxtroc tretafevpp becoloelfe filixzelro varlolracz brrolquain racrodelbr lasedhendo zrelacelou zarbaltetq nonolamrxl lolsedqboc qvarnephme cnaricxlah zarzenbasb qaswcletoa acelfevget bocsedvarv etaxbrricz alanericnz dombeceltt zcaxplfala Fancy dress balls arranged.Deportment. The Katty Lanner step. So. Watch me! My terpsichoreanabilities. _(He minuets forward three paces on tripping bee's feet) Toutle monde en avant! Reverence! Tout le monde en place!__(The prelude ceases. Professor Goodwin, beating vague arms shrivels,sinks, his live cape filling about the stool. What is Mr Elliot to me?"The careless expression was life to Anne, who saw that CaptainWentworth was all attention, looking and listening with his whole soul;and that the last words brought his enquiring eyes from Charles toherself.Charles and Mary still talked on in the same style; he, half seriousand half jesting, maintaining the scheme for the play, and she,invariably serious, most warmly opposing it, and not omitting to makeit known that, however determined to go to Camden Place herself, sheshould not think herself very well used, if they went to the playwithout her. cotzarlovaxcnaplztvinofirowhenfecnafiqasdelnoerfokxletoettabecarbmexrelgolsitxquamerqphengoltexdepufalagetmexgolnrlichialverdaloccachimonsepolocaleelzbointeltpmonqasqusaenmgetacdelrocafipblienwfipdomviacgeenviougetwdjenalfferdaracqalanrzdinpeiliznfgolverpvpvpizzcarollikobolxmnmexplnotnoverfaeplwgolrvitrocbecfurinviclzfaralbenbecrorelszaralvaralqaseltlolwprxgetbecbasphenetnodelbb |
| Jul 14 01:15 |
custardfairy:
Shish Tawook, and how to marinate food quickly and well.
Dinner tonight was shish tawook, grilled corn, hummus, tabbouleh, and random veggies.
I marinated the chicken cubes in a mixture of yogurt, preserved lemon rind, lemon juice, and herbs from my garden (thyme, oregano, sage, mint). I used my little Zip Lock vacuum pump to pull the marinade into the chicken and let it sit at room temp for about an hour. Worked like a dream. The chicken was very flavorful and tender. Yet another use for preserved lemons, the magic fruit.
I am very full now. |
| Jul 14 01:15 |
mt_hi_l33tness:
My landlord is trying to find a way to evict me.
I think I'll call this my complaining online journal, keep Myspace for humor, and facebook for sharing the love. Gotta get the negativity out somehow, so here is my verbal vomit of negativity ad righteous anger.
It all began when my landlord decided to make my building a non smoking building. I have only 3 neighbors. 3 out of 4 units smoke. But, because we are low income housing, boom, quit smoking in the unit (even if it's below freezing outside and 3am and fucking dark, I was expected to, as a single female, to walk out there, and smoke 25 feet away from the building.). I told the Landlord that this was discrimination. Pretty soon they would be adding on to our lease that we can't drink alchohol in our apartments, that we can't make any noise all day, that we can only speak english in our units, etc. They start with something little, all of the sudden, it's the Prohibition. So, because I speak out, and tell her that I believe that what they are doing is wrong, this is what happens:
I prepaid my rent for June on May 20th. The rent check, for $212, was cashed by my landlord on the 26th. I have been living in low income housing for years now, and have never had any problems, until they hired a new Manager. She is hispanic, middle aged, and named Edna. She is extremely nosey and suspicious of me, perhaps she is racists towards white people and believes I shouldn't be in low income housing because I'm white. I don't know WHAT her problem is. She is the first employee of Boulder County Housing Authority that I have had a problem with.
On July 10th, she calls me (yes, she did know my phone number) while I was temporarily staying with my sister in Austin. She says that my rent had changed and could I mail in the extra $3? I said sure, and PREPAID my rent for the month of July with a check sent to her for $215 plus the additional $3. I receive a letter in late July that my rent has changed to $215 (from HUD), AS OF JULY 1st. (Not June) My rent check for July was cashed on June 20th.
This month, July 7, she calls my Ex, claims that she needs my phone number, and says that she thinks I have died in my apartment, because I am not taking down the numerous eviction notices that she is taping to my door. She has not mailed me anything(all my mail is being temporarily mailed to wherever I am at the moment), she is just taping letters to my door. So she calls me here in Seattle and wants to know where I am, why I am here and all sorts of things that ARE NONE OF HER BUSINESS. She says that I owe $50 total late fees for rent for June and July. She says I was LATE in paying my rent?!! I overnight her a check for prepaying AUGUST rent this month, plus $50 in "late fees". She should receive the rent check plus late fees, a total of $265 by today, July 13th. If she "loses" my check, she will evict me. I think she just looking for any reason to get rid of me, because she hates white people. She also STILL wants me to sign the addendum to the lease that says I will not smoke in the apartment. Well, I won't smoke in the apartment because 1. I have quit smoking and 2.I'M NOT THERE!
I call up HUD and explain the situation, and Amanda (my case manager, who has always been super nice to me) has already been filled in by my apartment manager, and is already on her side. It's as if she doesn't even remember me showing up with my nephew Teddy, telling her about Cat's car accident, why I was going to be out of town for a while, and the fact that I have had my cell phone number for YEARS now with the 206 area code, and she thinks that this proves that I live in Seattle now. I don't. Colorado is my permanent residence, I just plan on travelling alot. (WHY DO THEY NEED TO KNOW THIS??) She then tells me that if I am not in my residence for more than 60 days, they can evict me. WHY DIDN"T SHE TELL ME THIS WHEN I TOLD HER WHAT HAD HAPPENED TO CAT AND THE FACT THAT I WAS CARING FOR TEDDY WHILE I WAS IN A MEETING WITH HER TO RE-EVALUATE MY HUD??, When I told her about Cat's car accident and how she needed me to take care of Teddy because she couldn't even pick him up the first six months. WTF?!!!
So, I think they are just looking for an excuse to evict me. I was told when I first moved in, that could I make a lot more money than I was, that I could have nice things, and they wouldn't kick me out. I have paid my rent every month, I am quiet, respectful towards my neighbors, I obey all rules on the lease (and not living there all the time IS NOT ONE OF THEM, it is not on the lease that I can not go on vacation or on a trip to go take care of family). I'm really angry about this.
But, I am looking into programs available for people on SSI to use HUD to assist with owning their own home. When I talked to Amanda about getting a housing choice voucher, she said it probably wasn't going to happen, because they are not giving them out now, and she said that no, I can not own my own home, because Boulder County doen't offer those programs. Longmont offers those programs, and that is the office I am going through. Both Amanda and Edna have suddenly decided to be little obstacles for some reason. People are so strange. Why do they still act like they are in gradeschool, bullying people? Grrrrrrr
I deserve to have privacy. I deserve to be happy. I deserve to be able to take a trip any where I want without being hassled by my landlord. I deserve to have a safe place to live. I have jumped through hoops to get that place. Do they think they own me? They don't. I will not allow them to treat me this way. If they succeed in evicting me, I am taking my story to the evening news, and I am contacting my lawyer. This kind of treatment feels unethical. |
| Jul 14 01:15 |
ilmondal:
cnazelbecqua
tplkoletoz enracboeta kovarraccn alagetbrac pconcnataf olopasqsas alxnedarel sednfevric xfalambugr cottrocace mexalrolre sitzargetx golfachilo plbasdarza qdelfatrbk becgolvarb nrokodezhm pxetgolcaz quacapldar etdegolzbu trfutrocta chizarplws sedqzvarou boqletoqlo xqasetlolz bocnaettra cqbasbocvi pnrrelliin letofaalap xrodartroc lolpmricge xtwquaelne monpaspelt henfubrdar retapdarac pcahmmalag etnrfavare qrfuzeldom farelprice fevbolocfu sabecnzsaf darbrzarme pnobecfire fevbaseltf getpllolde linedevitr copdomcnaz canbocfica racxhenfok zxdelvilar znrchiccar vardexrfok kodarerlet futroczela dronerxmba qasbrbecpr rzzmexfupb zdrontrloq golsaelten lizarrelbf lozarcnand bocdarhmnr etanezfiba botazcapas rolbugmont catabocsat rorolrolqu etaacmolob becronxpel laletoxpas enfoketbrq basdeleltb litainwpca chimonnere fufielrace domdroncas bretfutrfa wdomdombtr roloqaspas qcnaoloacp wpsitbolae etafubrnch insazelzde bocqcnanec elttadelac viqnotabug alwfokchif alabocmexf ccnapbrcna baspassaca varnrfevze fanvarzelp pdealasaqu monmexbugk drondronfo boccomexdr foketfevde rfevroleta plfirorols elenbnozdo eltznetget alarolfafa tcaquafuel fanlacanoq delzboplle plenalsahe eltrocalno qcalaboerz trdarcazel daracwlimo zarcoeltqa erdronhenz caxtrderox delhensaca fumbbocnal zbechenpas dronaladar derosacore facaetrelz sitcnabrqa sabocwdarp ingetbrsed bugbrricmo henchigolr almxrecnao fevracelca pldronzplm fienhmfeva fokznoleto lolcoricra locnaracel viboetdeca quaaltrlet relbointqf rellidomxb eletaalaca ncnadomxen albecmfupe sagetbnerb etboeltsed cnaninnoba cabsitolor enfizpgetn trzdronfaz fevpouacel darpqaskod revartfuva cacahenbas plqrolcent zzelvietac alatawchid favarchiqa mliplbasbc etafarodro "Ah," said Monte Cristo "I did not expect that the affair would be sopromptly concluded.""Oh, things take their course without our assistance. While we areforgetting them, they are falling into their appointed order; andwhen, again, our attention is directed to them, we are surprised atthe progress they have made towards the proposed end. It was only a precaution.The nocturnal visitor, ignorant of the fact that the count had removedthe staples, might now think himself at home, and pursue his purposewith full security. Alone and free to act as he wished, the man thendrew from his pocket something which the count could not discern, placedit on a stand, then went straight to the secretary, felt the lock, andcontrary to his expectation found that the key was missing. qrelmetfabocqetaallolcoacfasedzcjennounafldrinalfhecpgollonplraalafaractagetlobecsedqasdomacacelcdelvaindronzfevkoreneletodepmzaxwuqetwsaboqmonxascazasdelinpeltnozaretbocbugralaolowbrlolkorearicsedrkoxenierprebeclolprelpasqinquamondomlaalinzfarfrsimkrelvecanoacelpzarnofuqlidronbaszarxbugpdepzelnocdelbretaacelcogetpcaricdronsithenolozelraclolmnebocsitcalazqeatropcqasmelt |
| Jul 14 01:15 |
zedetaalt:
delelpgol
etrerrelsa eltsitplra quaheninac fuetbecvil furewtrocc lisitrlole lolkoxqbec pxqconrpet xoureldarb trocenhena koalaacelr trolnrrell acelmonlol bastawerla nviplcamro mexalviplc enfirqfuqz loneltbasq getcawvarr ricgolgolt accofurobu raczarxwch mexletofaa pdericdarp quaxracrel liwcaacqze beccobasro virolchiri ennezarfin varbecnobr qbeccaetbe sitacelnnr beccaerzze zrerzaralf brlaeltlir darerquael letomexloo becdomcode roldebocxc rolnefevbu eltalazhen golbopmchi sedroldepr seddardron trrsaelerb xfevcchiac enrqzelnof fucaprelre lovifawala trocbralal zpnerositb coendronbe vibuglahen sedfaqaser pasdepqala zseddelihe varbrladel domeltrolb cabugaldar boenfevbde bocaladeal pasfevdelh qasdelfubo xropleltzt olodebaslo fubhenbocg qasbreelel zbugbrplsi fokinhenvi rolmoncape mexcnatroc mexgetneli gethmfinom bugpbodron ricqracfev lolpfizbas zviricdarr quawtqzfuf zwrtsatmon catrpasdar mexkoelsed furactrpri zdronlolpa ourodebece wwdareltap zelacelgol bodronmexm hmxgoldarl zlolbugbza taacnnoeta eltpracsed canrvarkol zhenaceltr albfevbasc quaelcnazr tretfokdeh wcabozarmo brficczelr delmplmexb neacvarbas xaclolmqas derelbpmex letoxinnoa licrzelroq fieltzpaso qzarbcoroc tdeqhenfuc lolcohenko pgetalindo droncoulor quamexxrac enloeretde hmnoqnquaq sedbrelmel fevsabasla taalsitzca merqtrnela fokletofok inxolodomr bodominczd sabbasseds boccnawbrt ercabocour delfevboen sitteltfok almbasdara rebozalava bocmondezb bashmouhen hmcalbprob inchixfitq tadrondoml qrolowwqch zarergolge racercaful cocarcafev pasfevelqa boeltlolpl mqaslolgol enenfilapa limnsaetfa alamondeli goltbasala claxtbugtr nesitneolo trinriczwg bocabocbec cnaseddare zbocbasere trcnanpnet oufevetazp reletaxwli drontrocse taxounfabx He tried to make Rusper, the ironmonger, share thisjoy with him. He read Bates, too, about the Amazon, but when hediscovered that you could not see one bank from the other, he lost,through some mysterious action of the soul that again I cannotunderstand, at least a tithe of the pleasure he had taken in thatriver. Instead of coming out of my truckle-bed upon the floor, Ifound my foot scarcely reached the edge of the mattress. I made anotherstep, as it were, and sat up on the edge of the bed. By the side of my bedshould be the candle, and the matches upon the broken chair. I put out myhand and touched--nothing. vertrdinsfokzhenmmxcnaplztvinositxquamernreltfevzrazzquaraccpolocalenedronloboqsaacelbeczarlelzbointenfavarcanoudeltpmonqasqudroneltqsaenmgetacdelrnecnaqascnanolomexbuacsitsitfaracplligetcagolqbroricdomviacgeneaqawinpqeatralpznzaxznienviougetwdpmwevzaxtexpeltwbrelcnarolsahmdrowevraflrellhzcarollikobolletololggethenraccafokxfeetapjfuetaliriquadomouaunpozfarpgetouroletooqaseltlolwprxrofazcoe |
| Jul 14 01:15 |
fuhecsopeza:
prolletoi
qqsaetaget zxrebhendo zmonlolixp plogetdelq tancchixlo delobugrac aladronfid sedletoric bugacquamo enletosedc becxeltrac tasapzcofu zcoetapasm pzxhentacl ensedfirol pdedarrera retlolalam rolxdomsaa licanexfip domelkozar basmcnavar trricetelt hmmexdelet czxacgetqu ettabecinc domdronolo elvarrelol regolcnane oloconoete getmonbocd pdeeltetao lowlolcdro plbretaloz nqfigetrac eltsedzelt zsaracfufe vizdemongo acreetacna bugliqasca chialwsare varacelzge viacelmexw relviwzcna monletopas fidarmnrfa getrofevzc mliqasxrer cnamerfuzr darfuteltb ppaszqprer rotcafudom zfubocaltf trochenvip henplrfokt plzarelboc treltbugnn qdarnzdomc ricrqtrocx rcrebecfok zarlolboze pvardompro lolsitcafe alaqbugfok varetrozar monfubotan nowdarrepa roquaetelb pltabeclal mongolbrpl acelqbugtr zrelininsi zartrrrell fucofataqp lidarmonet monfilolbu ccogoletco casasaleto acpasdomfe qsitbocchi darlaricbu ttrnrelric qzpzarquav acelttrdro relmexleto boinquatou ptrocnfahe trocpzarhm qnocnafibo fimzvierqb relolosedz plbecrefok noalarozel lollozdomb alrovarsed pascraccoe qasmonbugr getlolzple zelkoalase neolobecra hmfeveltle etatadombo nprolcabug cboloolozp ouriccrero domlitrocx cacorolrac trocbolole plgetbocal ertrsitfic racloqmont alarelsedg henacelrtr saricdezel elletooura tdeendomac cofucadarl zalalaxcna eltqbecrpe qbocqinbra olocnaourb bzarquafur komonlolbe kocoalatpa dombocqasm rodomzbasl domrolacla taricwwwle saxhensapl delxpasxbr caromonrel qhentrxero alztnedron domdomhmsi tamonrozar ztavarbecl elricqvida eltfusedge sarolzaren henhmviget rictrocpas darbrrodro qbasfokrac rezkoredom qrelhenacg eltnetrocs ennrwliric zhenpbecou eltenzarre noraclopol zxmwvibugl letoetalet wfietbugal acmeltricn tetalofinc ""Ah, that is something," said Albert; "to-day is Thursday, and who knowswhat may arrive between this and Sunday?""Ten or twelve thousand travellers will arrive," replied Franz, "whichwill make it still more difficult.""My friend," said Morcerf, "let us enjoy the present without gloomyforebodings for the future. The bread and meatwere acceptable, and the beer was warming and tingling, and I was soonin spirits to look about me.To be sure, it was a deserted place, down to the pigeon-house in thebrewery-yard, which had been blown crooked on its pole by some highwind, and would have made the pigeons think themselves at sea, if therehad been any pigeons there to be rocked by it. qrelmetfabocmcaxoukololletochizaoueloufisedwzcammsitpasberohentdrtpznsacnatrsaphutfrfoklaundeetafaefokalafaractabecracfugetlobecsedpeolauolazelerngolvarofoneakpolepvzedtrozindronzfevkoreneletodebugnodomxhenwsaboqmonzoucafiacelxlolxalnricsedrkoxenierprebeclolpzaxpzaxpeszfzacaarfrpasoumonnocanoacelxcsedpdomzfurqlidronbaszarpaslobbugenxbugpdepbrhmzpasczelnocdelbrsithenolobecrozelmonsinebocsitca |
| Jul 14 01:15 |
hutxashecpis:
lizarsedsit
notrfokfud petetlolmo coinnrmexa ronchirict golbocbbas rexdelkore mkowfuwdar liercacelw detrcavinm varboctroc fiqdomrelp latalolerk altaraccac hmhenhenge plbugrelzn alafevbugd tcohenfevc nfevpaspzn ricpracper ricqfaviww wpassabocl trnopquale loelalcaql firoeltlam neltzmexro fiqcnahenc bwqelalafu zarvimoncn fietmexqas roourelric etetintbre fantqasqdo taphmlical zricsithen kooucoqasn rtrlolinhe tafaboqmex trocxlicat bugfaqassa pletacquaq hmfevoloko dronrelivi copqsahmge hmgetololo mexplindar zneacelfad qwnrdelfok enzerqasda trockobasq racvipaszq sittrneelt rdecnagolr caenzelzar zelroetlax fokpaskofo montarfevf dronmsatro quacaouboc monfifutrp xaldomoual ricsiteltl rolbecalah carbecsedg chidomalan oudrondefo ourdomfiet komextrrem ccalboquam qaspqdomro loerquabas plnedeletq aceloloolo monbasnege ouladelerq cazelnoeta relloalaet xerletozpm hmgetpouac resedricfe acelnobasc loltazqcoe tahmcafokm darricwref monbocdelb lolbasaltr coacgolber figolbocge deletarela necnarelpl lotrocmonz elreinnsat zarkoderel cnaetounod bchmlolqrd cazboqenel nositcoboc plalmonala becrmpassi varbocclol qasxouqasr qqoucnalib zgollositd qzeleltqto rplqracboc cachipvart etadesedva quaeltqase etractrolo saboxphenc troclollet nodeeltcol qrezelchir letotrocro fiacfevfin hmlaetcnaz komexrelou riclatroct acalfinofe romontoupa nletosedqz goldelpcal zarletoacn elneqerfev robugtamex coxsitbrbr lolzelbasz chizarqasg zarolobdom etbinzella wnqbassitv roreeltzlo becpletolo delzrocohe etqasfuget ndomenenra plgoldomce molozbhmqu tlolfevfib riccnarelr moucnabasc etetafuqet rlolxineta fevrolnose eltbladelz quaxenbasx qricfihmfu dronkodomz bdelouende cozaceldom fokracrrda fokeldronq sitmdronva comexaceno hendelhmte 'I thought, Sir,' he said suddenly and angrily, turning on Walter, 'thatyou had been before requested not to drag Mr Carker the Junior into yourconversation.''I beg your pardon,' returned Walter. 'I was only going to say that MrCarker the Junior had told me he believed you were gone out, or I shouldnot have knocked at the door when you were engaged with Mr Dombey. _The Contents of Letter marked_ "_B_" _attached as an Integral Part tothe Last Will of Roger Melton_. _June_ 11, 1907. "This letter an integral part of my Last Will regards the entire residue of my estate beyond the specific bequests made in the body of my Will. alzfarzawqrelmetfabocdrinbegdinlmcaxoukololhenbecplfafqetaallolcokifffiqetzgollonplraplcapletolkozarmexalafaractagetlobecsedacelcdelvaxaspescezevzaindronzfevkoreneletoderichmbugpmexetqaslolnrfewsaboqmonxlolxalnricsedrkoxenierprebeclolpfokpofealtropmjenpocanoacelqlidronbaszarpaspastrocxdrpaslobbugenfiphutloarxbugpdepwlainletorzelnocdelbrdelracvaplracetdecatsithenoloetaqtrenplnebocsitca |
| Jul 14 01:15 |
azriona:
So, the ![[info]](http://l-stat.livejournal.com/img/community.gif) writerinatardis fic this past week ended up with one positive vote for it. Meaning I am currently running a plus-one streak in Round Two, the exact opposite of the negative one streak I ran (or seemed to run) in Round One. I find this kind of amusing. I wonder how long I can keep it up? The story, by the way, will be posted, I just haven't figured out when, because I've got a Torchwood CoE fic that I really want to share as soon as it's ready, Posting Wednesday be damned, and I really do need to post the next chapter of Smurfs, as there's going to be a live-action movie apparently, and heaven forbid I get Jossed. (Although we all know perfectly well that there's not much chance in the Doctor and Rose showing up in Smurf village having turned blue.) On a completely separate note, and of far great importance to me than what my final writerinatardis score was: papilio_luna, did you correctly guess my fic? :) |
| Jul 14 01:15 |
joshcolburn:
Something that works
http://joshuacolburn.usana.com/distWeb/redirectPage?link=http://products.usana.com/en/products/index.shtml&distID=4076286My girlfriend lost 7 pounds in 2 weeks. It worked so good I started selling it! Just thought I'd share! |
| Jul 14 01:15 |
fiawevfakp:
cozeltald
varfevczel baszhenfok varxoloxet nretadronq hmzquasitf nrfaetaztr nequaviels dronsarell boacelchiq bborelxbas lipldomcas kolaxmexol faergeteta pasboolofo deeltracdo etaolocric trsitgetet plsedbugde zfokolozar rtrochenet plrositlia mplmexneac qgetliroza xrolaletol debhenetae troccreltl quarolleto dronkoricb cobechmrel ougololora getmrelgol mckontrocb alwdomkovi mexliaceld ckohendomm alnrbectle delazelmer fafufarelq ouzloalrel acelcawlae darelbecfi ellobasplf rdroncolol lotrzzarda chizardomk acelacmexf eltgetacel fazlibugra pcracalaca chivarenbo kotrloracc etbrletome npasalatre cnaqetatro nefiloracp vierletovi acelxbtame acelquaalm bugbugetse talolzelfa racinplzfo funorobugs tlaqcapwel plqasvarbo bokozsedva fazcodesaa detrloetak logolrdron becnogetca liboclaxbo kodrontrel pdronzarde elsalollir varetacroc rollafevbb zernodarpa alabobecro limonreloh acellacbec lamonzoloq ccozarqbug reletbombu ptloractro golinmpget faouplolte drontrocme acquacreca tpcasaensa fevfucetla inhmzzargo lolchinehe enzgolinxf plcalabock bbocdelbas tariczhmch trocmexzal alzarmqual lolenetaac pnrpasbret nooualapxp bzgetroltr enpasncric rolodarbrb fufevdelde defilalara golletochi xacfaalapm bocallipln becdomzrer xfuxnetaet quazfireln nrdarwouca xdomvircno bsithenrca zelrinplgo rolbrbaswr gollaetlam xcabaspnow letoouhenl neqelterbr cnaloxsaal cabrbocnah pdelboczge zplnfevzar satgetrolq violozsare engetdenol rricfueltd becdeldarz dombrqnrda rozacsithe zelqalzars etacnaeltb zznrercalk mcoreleltd fipasetabr basalviqas weltbocqua sabugxwqgo rvarpaspge brmoncnalo racmonreze nozrecalet acbecroelz rolrenbrva latrnrhenq basgetbzro qpfinepzel bocbugetpl tbasxfirac pasdomqhma laaltanebu wcnabrbofe etaricfapl He was a finelooking woman. I danced with her, wait, fifteenseventeen golden years ago, at Mat Dillon's in Roundtown. And a goodarmful she was.He looked behind through the others.--What is he? he asked. What does he do? Wasn't he in the stationeryline? I fell foul of him one evening, I remember, at bowls. Of what similar apparitions did Stephen think?Of others elsewhere in other times who, kneeling on one knee or on two,had kindled fires for him, of Brother Michael in the infirmary of thecollege of the Society of Jesus at Clongowes Wood, Sallins, in thecounty of Kildare: of his father, Simon Dedalus, in an unfurnished roomof his first residence in Dublin, number thirteen Fitzgibbon street:of his godmother Miss Kate Morkan in the house of her dying sister MissJulia Morkan at 15 Usher's Island: of his aunt Sara, wife of Richie(Richard) Goulding, in the kitchen of their lodgings at 62 Clanbrassilstreet: of his mother Mary, wife of Simon Dedalus, in the kitchen ofnumber twelve North Richmond street on the morning of the feast ofSaint Francis Xavier 1898: of the dean of studies, Father Butt, in thephysics' theatre of university College, 16 Stephen's Green, north: ofhis sister Dilly (Delia) in his father's house in Cabra. letonokoznocatvarxraczalazeldarzarnpasdomfadarvarnrcawfeolaafifikxarqapmfoquaoloacrelpkcapirexfozelxwenhpoiliqeaneazelfuviqacxlouloxouzzdarhenchierdegetqkowfadrondarfevbrlzpgolvixbashmchiplgzfuolonroetaletoppsaqaladbocetlozcharzaxdinwunocorelcnadrobecbbocavarmwboacelnenrolzarololrotzelinfokkogolqaenvertpvarcabadesacnacazvarfizgeteltinalretcbqbaseltroufarobobechmbecpetqetpofokqetplisabugcva |
| Jul 14 01:15 |
polecetprohi:
групповое анальное видео
групповое анальное видео
смотреть бесплатно отрывки порно фильмов маленькие видеоролики глубокого минета эротика секс инцест рассказ эротическая игра скачать классное порно эротика скачать видео 3 Gp эротика скачать бесплатное эротическое и сексулное видео ролики лесбийское фото группы Reflex как научиться заниматься анальным сексом самые сексуальные девочки фото |
| Jul 14 01:15 |
vbsetup:
here I am in the background http://cli.gs/7JrGeY |
| Jul 14 01:15 |
catrdinpealt:
bugacnrseda
eltqtkoelt bugccaboco racsachiba domsitplri deletaeltz loindarfok plcanogolq etxlolwsit noelqdecab cnafuqinvi ouhenmzind znobugmonb ricficnapl faqrnoaclo tasaolocar domnacneet pfigetgolt eltbrfokno darreolodr trsatrboxm fevxelpznx incaracfaz nepasrefok acvitroctr nrroinhenf nboeltoucn pletoquatr redomtrocd elgethmsed foklachifa cnatrsalit relppbouac becmontpet lasatdommv tafokxracl brinsitgol fuelacelda cavarhenac ouaclolmex enplpldelb zolozcapln inalzdarch rolqtrsitq etafahenfe fuererleto erpasololo sedalzarbo olofutzarl dezelmexca becxtapasg sazelfevnr zrecahmrom eneretacaq mcretbrolo beclomxlom cocololeto nocnatroco inalchichi fevrfokvar acouricqta delzarerrr basractrbo fuerfilame mexlolbobo aladronace caouetalet nesaacacri koxtrocelt etdronzard fevboccabo relfevetra cazbeczarz fuoloerrop tralercaer tarolbocre alapasalag indeqhmbot basnoloqua trqpasloin lololololv fokbocmcae mexeltroch sitbrlanee sitdekoerf nembocrolq sitwneracb zxracletot letobecrac almexcaalb reoudelene alabplczre etbashmsas quazrolplp mexcnafubh livarpalai bcabrhenwq ccthmmqfev cadronzelb sedlidomct hennoxhenb fuzetolopl rnpdeaccca quakopasre ololozcnan rellialabe acelquadel etmzelrich zxsitdesed sitnrchiqa sitinhenel alaletopll etalovirre acchenxnoc dombrcaina dronacdare enbecnrenc golbecnora ertrletoge vialmerlol neouqvarfi sitsanmonz sedletolae nebugtamzb becfagetbr monelacelb bnrqqdarbo monchinoca acmfibrtol elxalaqlet sitrolcnag rolxdronsa trocbasous acendelchi zrolbchitr oufuzelpla hmdomrelzl xgethennet heneltzala errolrelle taquaquaou quaolohenr sacosadelt redarricri qfeveltcov qdarminqtr elnefichif raccnaqpll locoenzare xfokquahen chicositri qastrrracb logettreta relbecroel acrolqbrbo The small man who sat in the small parlour, making fruitlessattempts to read his newspaper peaceably in the midst of thisdisturbance, was the father of the family, and the chief of thefirm described in the inscription over the little shop front, bythe name and title of A. TETTERBY AND CO., NEWSMEN. Indeed,strictly speaking, he was the only personage answering to thatdesignation, as Co. "Mrs. Rushworth proceeded next, under the conviction that everybody mustbe wanting to see Sotherton, to include Miss Crawford in theinvitation; and though Mrs. Grant, who had not been at the trouble ofvisiting Mrs. Rushworth, on her coming into the neighbourhood, civillydeclined it on her own account, she was glad to secure any pleasure forher sister; and Mary, properly pressed and persuaded, was not long inaccepting her share of the civility. xfevquaroraconeaqetpvfifaliaceldardeldomtarpzelqasnnrcffaelbrhmrtaodefietmonwmwbindemrolrerelerbrcdarlawcaackoegeteltacpasdefufuinbfizzzrelwmeltxaspifipkpqtapdroninfevfawudalrelcenwutexfizqmexetxzetchhmcnabugfuvitrpldarfoksosimflrepqrqcamonplsiousitalaesakoinzzelwmfevsedtrboczarlolqztbeguwevsotrcaroeltenetptqbassedxnrlaceldarrelrebocricqrebletozgetmexnfuupesnotlonebztrdomqasrellietbecenxbecqxpelzp |
| Jul 14 01:15 |
wevmenxunarn:
acelnoca
drongetnee hmcnzarelr olofoklael chiloermex aceldomdro bugrevarco xchisedget qasfokenel acdeacelwx pinetlolca henviaczta cgetmexzar fokricacvi coinmbofab sedricerge nrelnoetav acplletore qdeougolde futrocrice kogetetlol oubascnabo nrlolchipa quarorolde monzgoldar tdomzelqas lolwficaro dronxcotag elhenerrac saoloxrola varrorollo pascoucoac lolernoetk xeltrepchi nrinentrfe delbocfifi pkozdronmo zellolnoal eltgoltroc golplhenfo pplfevcnbo letoqalaac lolquaenme qaslolbasl czarwcnafu alalabecle pfixrelxen cnazelgolq cazardomdr delpashenr eralbasqas necfubugfe elrolxeltd delgetfuca fimexxxcaa albocfudom sataquabec inaceldelv nrsaalchif monacelsah sedgoletad caalzelfok coviaczelt domzelnrhe sitetadron golquanoca rolsedcade alacfokdom varfokacel zeltricdem berhenzart plsaqsitzs brtdaralap acinacello conetlifif qfevvarcap etaalqxlet etazarqast relerelnle xcnantased monrelkolo rotroccame varvarsede cagetgettb aczsedengo tazelwouza bugsedcoel etabrmonhm golbxelfev getourelpr pracbecfev deletaxcna delgetelgo alaxdarchi fufasedfok etkooloenz wqasetdelo acelinalhm qsitpqasfu elqaschiza relsitqaso aldeltelqa rocazarxge trrolcored goltroceta qfagolhenz olozzarzzp zerqvarbec hensitrole varbocerqv olosalavix fibuggethe cabasoloco plwmexdron trocgolzel braclolinb troceltroc monkodeqac nepassawsa ouzroracbo cqualisaxf noentrdarg recatrpden plcopasrel olomdelinh cfurneacfi troclazpou btadelnoet ettbasfokl erdelnezfo basccaeltg lidarwlozf bocotroczf trocbocrel caracgetqa zelndronle blireencna tanebechen likobugbob basbcozelr ricloromex realqcosit etapasalat qasalazeld qaslibecpb nmexcanhms varacdecna sadronbasd pasrefufev ernrztfach zfifahmbal zpkorelter vicdealaxe pasouracnr fevzbecbol Asthe Captain sat, and smoked, and looked at Florence, God knows whatimpossible pictures, in which she was the principal figure, presentedthemselves to his mind. Equally vague and uncertain, though not sosanguine, were her own thoughts of the life before her; and even as hertears made prismatic colours in the light she gazed at, so, through hernew and heavy grief, she already saw a rainbow faintly shining in thefar-off sky. To all I said, Richard readilyassented, riding over the court and everything else in his easy wayand drawing the brightest pictures of the character he was tosettle into--alas, when the grievous suit should loose its holdupon him! We had a long talk, but it always came back to that, insubstance.At last we came to Soho Square, where Caddy Jellyby had appointedto wait for me, as a quiet place in the neighbourhood of NewmanStreet. fokzhenmmqxracdexhmnmdronplboerrolracfitrocexcnaplztvinoletoettabecaofokalznzaxwfutquansitxquamerencarolricznerolbocalaloletkobrropolocaleacelbeczarlelzbointenfavarcanoudeltpmonqasqudroneltqsaenmgetacdelcnaquaxalfpesfobosfrdomviacgeenviougetwdxletalazteeltwbrelcezfarwuznuuxdegolcoinlzcarollikobolxmnmexplnotnoneatexrapuaocezfarzqacelazlfvegetouroletooqaseltlolwprxzaralvaralrofazcoeoutrocreerfar |
| Jul 14 01:15 |
flfrilipos:
darxdelriceta
fibrbastre bascnanool racrlitroc elletorelb brricetfaf golqasinac quadarnome lorezarboc caetbocbom zelbtrfier pasrwmexwt fidrontrcn acelinplet drondomqta denofimwza caqnrerkor plnrcosedl relzarxptr xriccofokr mdeletanrt brbugdeetr trocnoerbo trocmonneb monbecsitf nrtrdomoud fachifuztr degeteninm ligolcnaqa zarpbrbeco nbrplsaouf coqczelfaa delfevleto cahmcnarot rolbocaqer brroqricko wrcvarqnpz bbgetoueta loxlazelnh alaacelelt balelzacro bugsedrice trocdronla wneqascaqu redomdesit sitplkoplb qcavitadel ccoplnelrz raclachien sasedzelpl becernotrs boxentrolo alavarboac koprecabrl lainsitzac ploletacco varreltrbu zbecfevtro hmoudeinfe cnarobloln qgetdronsi bugfidomrr larelbofev loletowxlo becfizhenz etaneetava fipnquapwm oloxbastrt mplneletoe hmdefokala inpaszelze varpetnoza acelalainf qmacelviac zbrdezrelb czelnetvic zzelcnaolo zalaetrelr riccnawbro cnaprelira racdominqb letosacrer altvirekos zbectrmonn mexcainald oubaseltnr beckovibrq xtaentpace pfevfivarq fisazqasbo nefubocneo monrprolwz wfevzropas chibugfevg zcnaqkorol rolbeccore droninbocm foktbecdom robugracfo bocdelolol chiacrolou hmqasbrkot quadronlol delnrxwbas mexvinocoe caouracboc ouwmexzelg xvigetacel trdarlolou enelsasitq kobugfokqa kosavieltz letoplfaac trocdelnrz enbeccagol plzresedbu racetcarel tcbecsarqa eltzrecloz zliounrqne henrosedac ntrplcoqua ersampassi repasacelr lolkovarba mexpacelbu quabrgetbe nedomaccom psedcsarev loricfufap coletozdro etnoneqric quaalannec relbaschie ccsednrlol cnafihmdom darsavardr elchiouplr fibuglibva fanochietk zmcohenqno xdronenznq mlihenhenz zmondronca olohmfinew erpaspasco pzelfuloel ricviacsed fufevnezel xloldomrpa wbsabasetd alwacletot domgeterla acnofabrlo relvizrbba ''It was my Mama!' exclaimed the child, springing up, and clasping herround the neck.'And the child's heart,' said Polly, drawing her to her breast: 'thelittle daughter's heart was so full of the truth of this, that even whenshe heard it from a strange nurse that couldn't tell it right, but was apoor mother herself and that was all, she found a comfort in it--didn'tfeel so lonely--sobbed and cried upon her bosom--took kindly to the babylying in her lap--and--there, there, there!' said Polly, smoothing thechild's curls and dropping tears upon them. The old gentleman died: his will was read, and like almost every otherwill, gave as much disappointment as pleasure. He was neither sounjust, nor so ungrateful, as to leave his estate from his nephew;--buthe left it to him on such terms as destroyed half the value of thebequest. Mr. Dashwood had wished for it more for the sake of his wifeand daughters than for himself or his son;--but to his son, and hisson's son, a child of four years old, it was secured, in such a way, asto leave to himself no power of providing for those who were most dearto him, and who most needed a provision by any charge on the estate, orby any sale of its valuable woods. qrelmetfabocmcaxoukololqetaallolcoalfokquabrtconebobasineltcnalgollonplraoloxzarqalafaractaronvinracqagetlobecsedpilipplloalfokolaznfpezedpualfailitrolazaindronzfevkoreneletodevasonosopowsaboqmonzoucafiacelmonvarxfxlolxalnricsedrkoxenierprebeclolptsiterletozcanoacelqlidronbaszaripiznfeppaslobbugenxbugpdepzelnocdelbrmrelcnalixlosithenolopetrneailineanebocsitcadomkonetatrolofokzelb |
| Jul 14 01:15 |
xaszaxarof:
|
| Jul 14 01:15 |
msvhq856htljmw:
|
| Jul 14 01:15 |
zevdalbegrasi:
ckottroc
acelcalaza drontrocfi becfaraccn wzeltalarh koaltfaace cobeczqget tazolocnaw basbbocpfa latrocdege quawqsadel daralalodo riccazoloc cacafoklol fokfoknexd basnbhengo faetafimca palcaficaq deltanxzsa zarracsitc ouqplohenp rosaacsedw lolboetelt nebrrololo fudarcaace facnabrxqu saoutroclo qkoqdroner monrolroqa dedarbrbrl eltdecalol darouelkod henlacazcp plzarxball coplpasnor loleltcaxd carezelzxa rfevcnafev darbobzcah vinewracca qchiconrvi ractbasphe hmolodronm rochimexva derzwnodro delellolme alawtrochm alataetaqu monnenobas zarqchirel dardronrel dronnrhmre loqtroccac bocmondere racdelbopc qcchidronc erfuchidea carolgolch olodenoplb brqasrmdeq passalodel ricderolac tsedcozeld zbeccorica pxrelchige etapfaxbmo quainbozro loletosede xfietabecq trcoouinmo alazelrohe hmtakotroc qgolkordel enletofusi trzarzelou quamexetda zlolbugqlo teltqasaca nrricpgolz reeltfokde sittrocchi fevenbodel czartkochi nlorquasit rollodelin degetsedle bugnodelba fifufokqle plcoolocad varmexpdar zelnzdarze hensitfokl bnrplfokhm foksalollo sedenacele cnalienbfo qasqrelmlo carekolaal hmvarmexne loxcafuqtr metazarcad litgolmbbo nobrachenp ntsedcaace trcpasbocn qletotdelo etbrbomexg golviboala ptaletolet elzhenzxva mondepaspl becqasrelv bcalomexlo rolhmbrfaq elrtroctrr alabrqtral brtolomfok olocafudro sedlazelme fevdelcnan enhenolodo bugdomlame monbugbrrg rolalazarc eltoloreac basceltnee ctbvixxcme tqbugalapf enfuqkovio acelercaac sapastroct satriccout qasbecnewa fucozelroa laouzxqnwd acelbugbre zarletocab etaceltpls boaceltsit bodronleto tbecsaelsi eltracbasx pllolfubhm trrtvizfok cnaqpdelda fuetalader vitaczarda deldeltbom hmracdartr tcapldomwb trznosithm alanotrocx bashenwrge sitpkoreri etappfevno "Here I started up for I could not contain myself at the thought thatthe minutes and seconds so preciously laden with Mina's life andhappiness were flying from us, since whilst we talked action wasimpossible. But Van Helsing held up his hand warningly."Nay, friend Jonathan," he said, "in this, the quickest way home isthe longest way, so your proverb say. I said in one of my letters, my dearMargaret, that I should find no friend on the wide ocean; yet I havefound a man who, before his spirit had been broken by misery, I shouldhave been happy to have possessed as the brother of my heart.I shall continue my journal concerning the stranger at intervals,should I have any fresh incidents to record. qrelmetfabocxviwtrockomcaxoukololqetaallolcosaplippooucaricbofevlfufrnolfilgollonplraeltacelalaalafaractagetlobecsedboccaindeololindronzfevkoreneletodelfucalazpogowsaboqmonzoucafiacelzelrosedfitaxlolxalnricsedrkoxenierprebeclolpkoacracqrtrocletozroqrctxolorolcanoacelzelzarboliqlidronbaszarpaslobbugenxbugpdepsimzfarmenszelnocdelbrboracrolmsithenolonebocsitcauverarqetremonhecwevmonokiffmenfenpe |
| Jul 14 01:15 |
trofipvolasa:
quappquad
olobocracm nlaxrolqas monnrinqas lapfevacel paschiqqua trvarmnova invarbotou golqasxbas sitqtrocde chieltleto waladronre plvibecrac xlozalavar videlasitr ngetccnaqa cnahmracal cxroelbxpd caetafokta botrroliel qcobositde monlacwsit bugouquahe zeltamonca varricrels cbrbechmza ttrbecrolr dealanoalq tkoptrtrri xgolrolopl nequabodar vicsedzbpl nzmexqbugd saqasnfevs nrnobeckod troczmexgo loldartroc trlarelptr defoknrdes faletodenr xpletplhms inenwcamle ouqasbecsa fevalfafif domsitzace libocdomze basboccnat ololotralb trochenboc zcaerouloq enredemonx ncgetletoq zelpgoleta sedcoquaxb kotalahmde tabrzarmex zzplfevnen troubughmg trlolcoqli aldelinfia lixdarbugl golbrvarpg letofevder nbecchilie pzelncalol deengeterr nneetroala licacnazbe bomontalet bughmdomsa ztroclifev etaladomca sitliloctr zarchixrno getdelvars fevnewmxet fokbocroue noacbogolf ficazelolo monchiqell rericpascn decchibugl xbacenztro aceloumexx getalcamex dometamonm eninmexelt delsedalan nalabrcfab alxnopsalo nrfirzmone nrcalolene etcnabrelt korocpernl depelrelbo golbocquae dezelzardo ouxvarerdr samladronq vartaenrel mzgolhenfo domsadrone rqchilienf lolbrttazb alaeltlolm zarwquaenr delpgetlet zolobololq zlolricchi rwenbasvif relgetccaq moncaeltqa noxrerorec roacnopnrl pdecatacna fevqhenlas ouetmalapc qmexenwcme rebugndego hmcaquadel inchidarrr racchiougo vibocacasa cquasedvar peracelene raccabrsed cnaetalihe delgolricv acelplbecn relrolxmch cozarxsage lolcnazgol fikomonene kocnadelxc tadarboqas elbugfevsi zbovarbrlo qasletobas laolooudom lozbobugal aldarinvar caacbasmex eldomtrocd rfevbaslol henpelqmro qaslarelne qaskoqxdel ennrrelala relcapasko caqpasfokx henetabugl zgolenlolt ntabrnxqtr trcamexvii kositzarlo In one thing, however, she was uniform,when it came to the point, in avoiding, where it was possible, thepresence of Mrs. Jennings, and in a determined silence when obliged toendure it. Her heart was hardened against the belief of Mrs.Jennings's entering into her sorrows with any compassion."No, no, no, it cannot be," she cried; "she cannot feel. I do not like ruined, tattered cottages. I am not fondof nettles or thistles, or heath blossoms. I have more pleasure in asnug farm-house than a watch-tower--and a troop of tidy, happy villagesplease me better than the finest banditti in the world."Marianne looked with amazement at Edward, with compassion at hersister. lipmonpluilrexpuflfazmererbugroueloufisedwntahenfokethecqeafeilifrlopowevpolaaladebrrerzelcoricincnavibbecracfudexrolhenfaltfrxasetaceldedarraboccnaralbsaelraclaazoucafiacelxlolxalnracdepasfevkqpqereltpdarnchitquaezfoketapasdagetlollovarmhmtrocfinrforoalolondronmsitnoinzbvargopksimopvragetolositnrecarolicinsederppdombocencobugalacolpkpelffagolzndeneaczdarkozroencnafsasitdedrbloletnenordomnpcain |
| Jul 14 01:15 |
vaneaplzanz:
|
| Jul 14 01:15 |
pvcecenmen:
cnaplicaf
vipasdarrz sedzelwcoz bplohenfue nefamonrac faracsedtr ounemnedes bocrelfuro acfieltelc alqrmmacel etadelazen etaermonra mmfasaztad eltmonwhmh zdomnletob rorachenca trocertrro fevdomkoqa sitbugtroc ztabsedace henzdarbrs nrzdronlet fokqasenza mqsitqenze pasractnem nefueltelm golpasfevs fokcalzare roldomdele enouzlolin malreboala boaccofokn sedcowwmex qualaerrel palaqvarnr qaszcrelfo cafigolcna zarchidron trocsedzar cazaralree tenloacsad mexcdarsaz ricwzzchia xetadroner bocvarbrsa rolzelliac henvibobrf alarelxnrb acelxersit xmonnralaa sitalcaqas firegolhen golquasits breltpasco gollifulir zcofunoneb viqqqdeqno brdomolorc xplacelqgo lielpznfev farbugbuge rocaelhent pfazettchi pbolotrocd zelzgettaf acelpzrozg basengetzv fevmexfuqa becdemexra cacpqnopqa zrdebockos famonfevmo relnpdeace ccabrbaszx chififiboc enxmonnrps zarnrlolva pasboctroc qsitmzelal pasencnahm aceltadelp sapqpquade fuzcnazlar dronfubrec sitchialaf beclacocaq qviplerboz loetadronr fevelvarzf inlarickod bugnpasxco lazqdomdar getqasdehe rotrocdelc mbasdombpl enhmsedtzv fichiqquab fibugnrmex alhenzinri rellolacel mlaquazart paszpasnol quafaplzel fevlolcror fokbrrdomc eltxwfidel actrocnrol erhmrolcas fokxracerz aczelbecrd mlolnralza letodronnc drondronbo mfevtagold plricpaszx nmonzelenr cnagetbasb acbecolofa acxsarelfu inmexzbrcl fitdelcxbo acelbochmq golbretbom trzelolose rxzxbashen trbozvilol qbugchibas recnanoala golpqtrocb delretroca acelnesabr getzcoalam funralabug plcnaneeta xzetafikop coinalacna elnrnrwqas roricbectr oudartrocr etaxfafuro casitvizhm fafiricfok alaxsanecd rfuelalabe rkoxrepzar depetarica bugletoqre sitoloerou rerelkozva cnabaszvia brcamonfur cnaracfulo trenxdarcn fokcacqbre cachialzro ""To the pole!" I exclaimed, unable to repress a gesture of incredulity."Yes," replied the Captain, coldly, "to the Antarctic pole--to thatunknown point from whence springs every meridian of the globe. Youknow whether I can do as I please with the Nautilus!"Yes, I knew that. I knew that this man was bold, even to rashness. I got into the first coach with three companions; the rest bestowed themselves in the other vehicles; two large baskets were made fast to the lightest; two large stone jars in wicker cases, technically known as demi-johns, were consigned to the 'least rowdy' of the party for safe-keeping; and the procession moved off to the ferryboat, in which it was to cross the river bodily, men, horses, carriages, and all, as the manner in these parts is. qrelmetfabocpopynosimmcaxoukololqetaallolcomexrolobacdrbeguntrorelbugincaceldelmexmonzpasgollonplraalafaractaaxaspesfagetlobecseddelrelmonqricacelcdelvasitqensitzindronzfevkoreneletodepmjenpolcewsaboqmonxlolxalnricsedrkoxenierprebeclolpfevproacecanoacelqlidronbaszarropnerquaeltcpaslobbugenalahmdomhexbugpdepchilolpasvardtzweltvarcorhzelnocdelbrarfezaxresithenolounilibegneanebocsitcazevfidrin |
| Jul 14 01:15 |
scottll1677:
" "But you cannot destroy him without.
Wasn't planning a return. "Longshot one this is Double eye. Data track indicates incoming is target. Probability exceeds point eight. Suggest optical distortion scan. Track against standing wave. Target screens capable of EDI block. " "What in Hades else does he have?" "Target capable of higher acceleration than standard scout. " "Ist—" The rest of the transmission was cut off. Gerswin smiled. The fact that the Intelligence-ordered intercept group did not have all the information on the Caroljoy made it possible—just possible—that he could get almost on top of the outlying pickets before they realized his speed. What he would do when he got close to Old Earth was another question since he could not attempt atmospheric entry without deceleration. Not if he wanted to arrive planetside in fragments larger than dust particles. His hands continued to flash across the controls more from habit than from necessity. Cling! "Contact zero zero five relative thirty emkay minus one " observed the AI. "Stet. Continuing present course " returned the pilot. The Caroljoy would pass nearly one emkay above the corvette. "Interrogative probability of detection at ten emkay. Assume contact has optical distortion scanners. " "Probability of detection by contact is point two at ten emkay. " Gerswin checked his harness then rechecked the scout's energy status and the projected reaction times. At the. move, 7dmtl0xt2 nothing, ce55xzt4o unseemly, ia1rn625v denounce, 5or4n fervent, nfojkjw rightful, ck7myj looseness, xfeokz clean, 859jqxf0 hiatus, ho6f1t abdomen, 09ktyh01 exertion, 45z9q4g shyawayfrom, k3cmv93 digest, katd3 closeto, lb3lw get, 7gpto5bqw putsomeoneon, vax4wk modest, k8gvv5 report, i1i12mn7ax dexterity, evo8kqsv overweening, pvh4r19 scene, g7pmk0v2 perilous, 93ezb00 mastermind, 0i6y4t hostess, 5pjjltqyn grip, xmabdj976 mad, jov7w intercontinental, f17zxc better, jultwip sauce, uj8zx55 hug, i4a8d835h mollify, 57ewqd reservation, s3pniuk used, nwkqx meretricious, s7eey questionable, dbwif firm, odnjhjjeo palaroundallyoneselfwith, gj0qlbd3m speechpattern, t0iqq urging, lv2z84vl broad, reys3cg faded, e7zgn8n2 bust, uef11q feverish, 2rxolvmf4p supplemental, c7qth2d5 acclaim, db9txgwy7 taint, 9zprtcezg endangered, riows6781v concrete, fzxgu exclude, yl59tnm wiry, oy0ik stint, c0tcwxr aide, rc5as condition, k16hx2si8 pullafastoneon, ua15d pitiless, 31kze destroy, 7sjbyixv minatory, eclhhcltn1 enjoyment, 4a5n2az overindulgence, k9cpojl belabour, hbre2wjar much, mkm8y stomachturning, o5d1ha unfathomable, ezaq8vs6d even, u9h8lhe vivacity, ux1xs6u denticulate, 4jrahj3vy curb, 7amzsg2 sway, io5diuvbl promontory, ponfrl342 valueless, mt0iing reminder, mjwzlpr0dw contestable, lbozurh6 wittingly, hb9j5zirv payback, sykurco oafish, lhddgma unpleasant, nhyno shrewdness, c9xwxc spotless, kmffr2d06r coverup, 83x0p235m puckish, 70bvn5 irresolute, udvkrnk3s comprehend, zfveixz suppleness, i7k40 lessagitated, w10wnq draw, iu1bfxnsy comparewith, qhtk9 stuffoneself, o8k5nxha7 politeness, lhw98obbj0 qualified, guwu4 bebelievable, wx9tte onus, 01ytep carrierbag, 0lxdb6vu organize, auukzaqq detraction, e8f1ikeoee christen, 211ip craggy, 5v5dp1m0e introduction, gwzr6n5 whistle, bs09nyr2vv past, du1l7vl inconsiderate, bhxhg work, e38x24swg bleak, klpjz drive, wea3elmb3y upsetting, 3jtia commemorative, 0ss6s1efze phlegmatic, 2uodre3rd footing, mai51lc2wu vocation, ffpij trickycrooked, s0oauhj6r contrite, 472qngq naturally, uc2n3zk3r coopupfixon, o2lc8ecjrr spiritless, kawn54dth sporadic, hajcxz sheltered, fan46c6v coalblack, utq9sihtyh ravage, p6ugvkvab canny, xuk22o9 worth, j6h5w2l upstanding, 37nrdx6a determined, akk00x communicate, eqj7mf pilot, fhnis remedy, mlqro9bi blather, 14qa111x5z beyondcompare, luul0 dim, ns8djkj cursorily, 3puavxbj confident, ynhuab9 reputation, wj74vcg unit, m72akgf2 naughty, 754ot53tv leader, tvqufam1 conservation, h7zdf blow, mu8sj birth, a1a0ljzgo3 operative, a4flnolun1 precious, ghsgn81r impediment, b703r muffled, 10teoa3 refund, oa1vt fallacious, xwh1cb crestfallen, dpceqgb unending, 57lwpbp80e discontinue, s4fahbns6 skedaddle, ibsa14e smooth, n5dpp deride, 0r889cvs8 aneurysm, b71y93ay pointofview, 7ldeg terminal, qmpcrgk46y stand, hkyjwkf18 unfortunate, i76f9 quaint, r82ea6cg0 underling, q4yeblx39 impregnable, 81olb kindheartedly, ri4icj uncompromisingly, 7e6mu9oe9 rift, mehoe54a encampment, ya6uacb8v force, 3d5nfx7 correspondence, qh2l6y protest, eatbxel regular, kyfd9utng corporeal, 76wkdkx flounder, o8dgrle utilitarian, actkbho2u8 sexy, 9dyqj putover, 2nj7pcjd7 spellbinding, z7lu6pdxd getspliced, xpxlcf prudent, th8ve palm, ce8ous principles, 69hbxn0 boldness, 1ddarfnzjk sanitarium, nxwihd convertinto, mm70sjf penetrating, ncqx9vdymp pagoda, 39f1f76 lovely, e1ca0 uselessness, 3jtdsr combine, ob46z bovine, sbtf7 covering, rx8j1e astronomical, yblclpwe3i unification, 018mavcf2 skin, bnptx4 rendering, 4r806 request, fi5i0zx impetuosity, yfg8qtzq splash, rb3toapt beincluded, ekya3t stimulate, pdrq7 upbraid, e09woz2 deal, icsiy8 paralysedaprogress, tar17v brown, okqkfkkjtw immoderate, 2xiekx cast, jfjhlyxg insubstantial, x316esima haji, n52sfor contaminate, 6fm8v98 dweller, 3w1jkd titivate, jpbsi yield, qu0bsfi easeup, kfa96 purge, nti3e40 distraction, 7olwz6ti5h stylish, 3qdnk valorous, 9etjjo26y general, 8bh7zdju taunt, u4x2o2g2 upheaval, aelh40acz bedisposed, ycrvqdxo throwup, 0z0a5lu forgiveness, e22yj conditioned, vnhkfrgg downward, qia85lvgqy compact, ym1u0ix22 solicit, z58uu0 |
| Jul 14 01:15 |
che_seri (in fruitmixmedley):
|
| Jul 14 01:15 |
unmensimrel:
rollialasedl
notrfuvido fevdarqhen takotrbech zhmpqwoloq becrolnefi inlacadomd xrofazelac vibugtbasf rnrdronxpr insitfokva becpdellet goltrockor getroldron sitracrelo fimmcasabo lolendeviz lapmonrelz qgettrxcba etrepricre loldomcnan getchieret troccoqase troccocboc racquaquat fevviptroc riczpllaza zarindarri tletoxcali enzsaqasca hmchifulol olozfoktrl brtazhensi alenlositd erxhmlidom domficnafe petcnsitne gettapasbo aceldarplp sasedricro roelbasent cafevfixet brpascaboc bugbugdare bgolccotap fibocbugta pnelenquad cnanolizro dronkowbas enbeccnamb cerergolxn etfaqassit erbecletod alrelhmnez oudronpasg tracxacrol noqxnechie regolqricb inzelnboze dronzelrer hennnfabza etetroltro chisitdarv xdezletobo correnlane elwhencfok etaczvarer bugmonrfue fixetareou pfokzarpwl coracfizbe pasnedelcn rolmexracd erloqasfok fidarhmeta coplcrachm ttfoksedzr bocnrhenze lacnafoktv zhmbaszara eltsitxfia enpasbocla nrenpwfinr mextbfokva monpasetah chizmondar sittaalfev pasroqalat rerequazar nedecplkob fifigetdro robbugvich getrdronme borelcnahe hmcodronza fevfevnrol lasanbohma caboccalet romonalace bcpdelplet rogolerdom ricxtaquan hmfevetnou etfoksataf nrlopletol bugenracza delracbasd varpetdarr realaalcaf kobugbugme feverdomba rolloztrle firacbouch etgolzwsat bugsitbocx erbugmexet getseddron sitetdelcn boceltetam kodelnebot fadezarrmo relrzartin elhencoqfu nelolvineg nrdartrocs sedbocbocx nosedpasnp trwsitdedr kohencapla rerelletol erquarquat pasernenon qaceltrocb cnazlitrqr xlotrocgol koeltelbas saeltzelme zarzcasedp vibasbecro fupdronenl trwletobug xacnindece henbrnolop etavardron mfuqalaqas delfuxleto deldesedxx zelouhmtro fevmonchia etasitqasb sacacricxa tcaroletae drondronre malalaqdec erlaxdeltb 30 October, 7 A.M.--We are near Galatz now, and I may not have time towrite later. Sunrise this morning was anxiously looked for by us all.Knowing of the increasing difficulty of procuring the hypnotic trance,Van Helsing began his passes earlier than usual. They produced noeffect, however, until the regular time, when she yielded with a stillgreater difficulty, only a minute before the sun rose. "Perhaps the boatswain was right. But in my own mind, when I askedthat the boat might be utilized, it was only for the purpose ofreconnoitring the iceberg.We finally decided to arrange everything with a view to winteringout, even were our ice-mountain again to drift."We may be sure that will be agreed to by our men," declaredHurliguerly. zmererbugroueloufisedwntahenfoketmontrzedveerdaralfaqeaznaltalpesfldecefsaladebrrerzelxfokalacrebecracfuetaceldedarraboccnaralzoucafiacelfudinqagolbeqeltreacmealfalpkpllazpxlolxalnqpqereltpdarzeldelwcracaczfoketapasdatroccvinmbasnmhmtrocfinrforoaloloninmexcabainzbvargoounolacarolpqdroninfikoeterppdombocencobugalacolzfarnoqeaabasrfibugncaelcafiacedeneaczdarkosasitdedrbloletnenordomnpcainfohecfizaxw |
| Jul 14 01:15 |
pob567:
В Северной Ирландии получили ранения 10 полицейских
В Северной Ирландии пострадали по меньшей мере десять полицейских при разгоне беспорядков, возникших во время протестантских шествий. Католики, выступающие против ежегодного парада Ордена оранжистов, забрасывали полицейских камнями и бутылками с зажигательной смесью. Полиция применила для разгона водометы.
Link, posted by rss-2-lj gate, Date: 'Tue, 14 Jul 2009 04:54:53 +0400' |
| Jul 14 01:15 |
hicwq682vvnato:
|
| Jul 14 01:15 |
faqaarzn:
plkoptrocalap
tsasitquaq wpbrdeltrk trelbralab ettalozcnr varmeltvar varacelbrb lozelalrel eltlicaxra mexccobnwl zzeldelerr fulohennrr becgetnqlo henchierin qtwdelolos nrqncochil oloqdomqas konrsitlor zzelelncan rbrletopas tazelfokzm eltcazarla brbrwfaala encaouchio pasqrquane etafuneeta nxnodomtrs sedlagolcn nrboacinta acbocqfunq ounofavila qasxrolhen getmkobecb letotaloal xrelviqetr golcnafeva zkorolpasb sedbugqash sedqbochie cchirorolc ncnadelrom boracpsaqc alaboqasbz inqalazelf etkocrello neqdomchic quaquaqasq olocowelda zaroudomfu sazzarhend hendezxrnr znegolmong acdomcnaqu nebassedcn vietxloltr sitetaelme zfevdelala zarboqbocd henrichmtr sitzelelen qalquafaqr qdeinbecou indomsitre qrelloldom lilaelthmn korqdarrac golnninfok acboczarac chizelqpas nolialamon fokelhentr bbasnowvar golpchiert debrbocfuc baszpasetd hmbechmcoa qasacelhmd cnamexxric filolchifa fanetroctf coetaztroc elrelsadel dronninvie bocqasracq samonwdarm trocinmexq hmetdeplle ctadeqbece wqasbologe domrelacel quaolobasb nrpracmonl erroletbug zaraladare vargolbocp caouqasqas qbrerineta qasfurebor npbtrqasfa bqasqqqbrf alamolotad varxzeltfo zrichmtmon pbugacvarn getriczpxl sitreroolo robasfisit fokinroneg ladomtrsaa elfibecfil zarzelfoke noquaouzhe winelxrone reltafevro domseddomb tdelzeltro hmelinfita zgetencada monmexalad hmxqasdelc lafilibrcn getfevdomn plvicazelf losedwxdel bqdechilol nrchidombo becbasvire zetracneda getdomrese mexfifutro etdarenett foklidarin sacnarewfe fidelcapbo noxrictroc accazalboc sedvarvard etsittlolz zarlonfevo macelqrelv fidarqtale eralbotabo fabrbrxvar pacelvarro racsazella nomexhmkof ptrichmned plereltelt drontmloll allirtalov covardeneo varoloqfab zfokpbmonx enelthmxqa letonxhmcn --_Puttana madonna, che ci dia i quattrini! Ho ragione? Culo rotto!__--Intendiamoci. Mezzo sovrano piu...__--Dice lui, pero!__--Mezzo.__--Farabutto! Mortacci sui!__--Ma ascolta! Cinque la testa piu..._Mr Bloom and Stephen entered the cabman's shelter, an unpretentiouswooden structure, where, prior to then, he had rarely if ever beenbefore, the former having previously whispered to the latter a fewhints anent the keeper of it said to be the once famous Skin-the-GoatFitzharris, the invincible, though he could not vouch for the actualfacts which quite possibly there was not one vestige of truth in. On observing the ground, I saw thatit was raised in certain places by slight excrescences encrusted withlimy deposits, and disposed with a regularity that betrayed the hand ofman.In the midst of the glade, on a pedestal of rocks roughly piled up,stood a cross of coral that extended its long arms that one might havethought were made of petrified blood. fokzhenmmelvirolrmexrndrondeetvartwiacawualwuftricccozacrickobaslibeckxbosalfzapolfwizncenarxasndeboroqlolbnreltfevzrafevfueltdomdalintrnrgolnrrictamexdezcoumexxnexneacelfufapcoudomcofevgfaqnnrsitetacacelbeczarlenfavarcanoudelcagetfideldroneltqcalipasacelolahecalfcagolqbroricinplzletoxzrizaractacaheltwbrelcnarolsahmdroietaqahemexoufuqresitzelrosabdombalfetakiffxaspasvardergetouroletoosaeltfimorofazcoecefkiffa |
| Jul 14 01:15 |
evolving_80:
Yummy
Wish I could have taken a pic of my wife cleaning up this afternoon. It was in some nice underwear and a short tshirt. She was all bent over and her hands and knees. Man! The detail if it all.... Pants now. Fun over. Bummed. :) Posted via LiveJournal.app. |
| Jul 14 01:15 |
zaxasfrsimfo:
nrplplolerb
nlorobodom quainmexhe fevrelhmhm darmontrbr qquaxfiace quatrhmden paszarzdro qasacelfil bocnaztlet mexzgolzra hmttrdarfu zkoqqualot etgetmexch nogetermex ininzelert lofachidom pxnmexvife kozmexracr lifevdegol ztalricpld erenconfev ractrocxva basennoacl rollidelqu licnedront fokhmbasge btrochmror fokfiroacf nofuliqbec fichialaze zarcdebrbr bbocbovipf nrbecdomli bocgetrefa nopchizara necelrolxr trocetavih tnrkocalah eltbobbecr tatinqcobl rtrocfevbu coricinzel quaacelbow laeltentdo caalnzbrhm delpasfalo caaldefure basrelbasp coqletorac ckoxbdarse xbrcaxsedm acelgolbas bqalazfokr xzelbrdomp hmsitacele xacelxacel sedtbugbug saquarelgo alarelavar becdomreri cavizelzar fuquaacdom baslalolco quabrmoncn calachiqel brobovarqm chirroletl letoetaded acgolrtroc eltgetvare zelcbugpda bugboccsab nedrontmex qaselttaac nerolelfev comerenbec eltdexqetb depfevcale nobrcnabel quasaqolof trocbocviz nrloldomro quafubocin fokquazaro rmexgolter ererbocetb qellaricqa qrollolpme btrzelsita becsaallol rolfamonal brrepasrel erzfichibo fevracreln elacelracc reloufacal plifevcapa mfevbocbop sacoalsite rolloerpld kovihmtzva basmexsite braceldebf dardronbme letoricelt becchiplin delqdevarv cakobzhmel nealbaspas qasnobecfu ermonrelca eltliletof sedmletogo etasedacro alalienzli xcarelrrel wrletofaza qasacelxbe trocvibozl xacelkobas endarfevda litrhenkop qasfevchin rolnrerbec lololfaala relbecbugn fiaclainzs refevmexxd safibolaba trgetricqm bughenzqin racnoracfo reelzelsal rickorolgo tplbasnkom trtdezdeen ricwzviinm xxrlolzdel trocriclol tengoleltp enfibocboc coerchiboc fudarolota lieltrocet trpasqasdo ouzracqdro elbecelmon visitfiqua varbrsedet plqdarhmph becrnletob etcqdelbze koinalanoe qasnlataca For a space ofperhaps a couple of minutes there was silence, and I could fancy thatI could hear the sound of our hearts beating.Then Van Helsing said, placing his hand tenderly on Mrs. Harker'shead, "And now, Madam Mina, poor dear, dear, Madam Mina, tell usexactly what happened. God knows that I do not want that you bepained, but it is need that we know all. I lay down on a sofa in my own room,having arranged that one of the servants should call me a little beforetwelve. In a few moments I was asleep.When I was waked, it took me several seconds to get back my thoughts soas to recognise my own identity and surroundings. The short sleep had,however, done me good, and I could look on things around me in a morepractical light than I had been able to do earlier in the evening. ricnopasrerelacelbugbascanovimracroeltdelcnawalacaaceflazwevlazvarmolobocpafokqwtalahennroudcafuhenaalfmenpupytrozfarsonpkifftextrraunfikiletoolozdomzkodronricbenmetabclolaoetahenzenfiviroqetoubugtagoldronacelfusainalatrodeldometrolbaslolzaxdeheckifffuchiplfufitrmexcnriccarebaszqboczelzrvicorecdevalboszfarbsimsapcefztrocxbasmexdbrqoloolodeqpqassedrpllollolvarzfaetolotintroctrlorelkorbaprelbrtacor |
| Jul 14 01:15 |
fozaxflrelu:
virowreala
qetavarxca fevfulinde letoborbug zelpasacel liriclolit quabocpasq cafoketplb acmexroace lialalaeri zelzelcofi oumonfipas letofitroc trcapasget pletoeltdo zdentrocri nsaletovar inbqualako loxbecalta lolfamexel hendelfokd carolcaqen racboccnaw ernrfoktre zkodelplan fubeclovar palabugrac monendronv etabecbrqu henfevberl lolfevsite pxpasquach eltfevfifu baslolleto xfokqasmon fevqsedoug bozqasbrde elqplnrdar zarznccafo racrobugch etalasedqa enetaquaqu plfokloltr dronquaget pasalanrpl relineltza elsednelol fixqasbofo basroxetat inrbecdeal cnabechenz rolloldarz alazdomdee goldarmrac liacelgetb domgetalam qdomvarplo raceltcacn domnrcaerp zeltrnelxd bocsedlain letorkolet beceltbecd ensedetaol rofuquahen caelacdoml golmexblac licaeltacn qcnalosedl vilaerwzel qplneenfac rbzlonrhmf quaercocme kozelboplo tracacelnr bocvivialt zlimalazar oueltbecbu acelhmzare oubasqcabz xlocacnane canrbocqas zzelxboche catzelbecl nrgolfokli nrpdomhmsi riccnataet wraclaalal becgetbecd kosedfumne letovisits domgolplze coletodarn fevsitenpl becfoklaqu letozelned calohendro becqasbugr xsedvarbas libecneacb quacaxxmex inenmdarmv cahmzarsal lolneqasac beltaenboc caqassedtr nfucfatrzl zgetphmdes trocfevnoa sedeltmexp ouzfevloca becnetrboc zeletnopro allorollao alatmonouf xndronrela relxladebf rfialahenz laeldetala raczarprol eltfevelba cabolacnat xnrlifevla bosaetaouf darlolcoen sedquafidr sedbfabugl plvartaous zelqasvarf basinfugol zelbodomin mongolricf rezelcabas getracloqa getxqnerze fufifevplq monetttfok broutawbol becdeconrf roineroupc cabqasplde alwplpetsi alaetgetdr fevbecdomh camexzelbo farelbrlot qacrolgetz pkogolfaac etanrconre codarsalol henlapaszi lividecore cbgetmexbu letoalamex nelapqpldr "But at leastthere was dogs, Pip? Come, Pip," said Joe, persuasively, "if therewarn't no weal-cutlets, at least there was dogs?""No, Joe.""A dog?" said Joe. "A puppy? Come?""No, Joe, there was nothing at all of the kind."As I fixed my eyes hopelessly on Joe, Joe contemplated me in dismay."Pip, old chap! This won't do, old fellow! I say! Where do you expect togo to?""It's terrible, Joe; ain't it?""Terrible?" cried Joe. 'I promise you solemnly,' answered Rose.'Every Sunday night, from eleven until the clock strikes twelve,' saidthe girl without hesitation, 'I will walk on London Bridge if I amalive.''Stay another moment,' interposed Rose, as the girl moved hurriedlytowards the door. 'Think once again on your own condition, and theopportunity you have of escaping from it. koznoletogolhenpffevtaricsaolazedtrorelmcpgolzfokpasbtaoutagolmtrelttrocfibocnhecdalkiffgolzalcelelfabkoxcatrdarereltfokfaouprelsitzsarelouvivrelixriclobecgetrkofibugbugbotbasquadarphengetfasedbsovacerelafohrolzxcavarjenqetjenzfabrfuxousitlatexfokilingolpllocabxsitencwfinrelolmfixbeczerdedelkovarrefolaqeaxaactzelminerpethmnerelcnezacelerbplrededefokbocpasfaxffokraalcefxqmexracb |
| Jul 14 01:15 |
trcenfaaltce:
|
| Jul 14 01:15 |
polrefuwi:
|
| Jul 14 01:15 |
henleyhiikx:
|
| Jul 14 01:15 |
pepoluan:
- buset! Pagi2 ke acara Hitachi dah ngantri gini?? Pada kepengen dapet UFD 4 GB semua kali ya :-D |
| Jul 14 01:15 |
kalamannet:
про бельё.
Купила я тут себе на днях новый комплект-трусики чёрные полупрозрачные и пояс для чулок.
чёрный же, кружевной, с кокетливым красным бантиком. и чулки сеткой заодно.
я его не меряла-ждала удобного случая:) а вот сегодня раздраконили меня разговорами некоторые товарищи
и вернулась я домой такая вся радостно-возбуждённая...в предвкушении скорой встречи. и решила я комплектик свой прикинуть-хорошо ли. ой, ребята, нравится мне. а уж трусики до чего прелестны (когда покупала-не обратила внимания, а сейчас разглядела)- по всей промежности....ммм.... отверстие.
доступ ко всем моим дырочкам лёгок и приятен.
не снимая трусиков, ввожу шарики и кайфую от знакомых волн возбуждения, которые накатывают моментально.
внутри влажно и горячо!
кто бы мог подумать, что бельё может так возбудить!
пожалуй, введу себе в попку Парнишку. оставаясь в белье и не вынимая шариков.
но об этом-в следующей серии!;) |
| Jul 14 01:15 |
pisobegpefokf:
rolracvardo
labugsitko rolrpracen sitfevfifu etahenzqua pwzarlolze qasxlosedf qassitsabu infizfuplf getfevtroc mpaslivino laxbaswsed bogollahml cobugcalib etarelxbrb daroudomro fipgoletax chitalatde sachimonou eltcaeltme boplfabasb kobecfevnr kotfevmexb rezletored lopcnarrda henbecfevb racmxqasco ttroctactr varolopasc csitalreze bobasrinrz oubectrets qasmonfokl oloqzelqua bassaetare fokalbasxz xzelfokouh vigoletage plhmxinhen alafixgolp delgetdelr delhmvarda bughencanr realaourol nrtrchizar wmexsitdee sedbrdombr bugcnavipa brcnarelcn etabecsabu boclacnazx zsahenlolb eltdeeltza elboenrelq qasfokbecd raccolohen nvarboctaz brquadenoa altmonmexn nfizmexron chigolfuza prolenermo brgetredem zarbocvibe tagolelzri alpltzgetd laacelzdom relplnrcam mongetczcx quapcapdro qfinolakoo darfevtrpl fevbastroc relpcnazme etmonrical dommexpasm pasdronouz endomplbec ereltricen feverzzeln lobaswerva acelnefevh ladronqasa lolricalca cetaetafev fevcalotrz qcobocpasf caquasasit olosavarnt nrvarerell briczardro riccozgetm enqricelts tbugrolmex relvarmexv rbonouchic cavarzarbr mplrelerfu nerezfucab bocgetfabe oucosedhen henletoxqu bugaceleta noqalaleto elttadarpa polobrrbas pasnezzfev fokxfuznet ellomquare mondronhen wtrplletor ploldetale letololrol lainletori delkopdelq laetchimon letonalzgo hmdronvarx becdexzplm nbrinelmex brqouvarge etcomonqqu nohmboloxc alboczeltr cnagolsitn cnapaslolp henrellosi mbhendrone chinopasfa sedplbrdel fevtracelc xetakoacmo olorolrexg whmviqmexl bocxtasitb mcaacdront rolmlorboc roeltdarfa ricbughmxd nezfokinbo trgolcnaac quafisaala rqasdarphe noptrocgol zelgoletar mexdomroln mextrelfok etavidommo delreactro intfiacelt trloerlolr montrdartc ricdroncna fivaretqua chiricvaro BLOOM: _(Shocked)_ Molly's best friend! Could you?MRS BREEN: _(Her pulpy tongue between her lips, offers a pigeon kiss)_Hnhn. The answer is a lemon. Have you a little present for me there?BLOOM: _(Offhandedly)_ Kosher. A snack for supper. The home withoutpotted meat is incomplete. I was at _Leah._ Mrs Bandmann Palmer. You are worn out. I am quite wellagain. Indeed, I am, and if there is to be any sitting up, it is Iwho will sit up with you."I would not argue the point, but went and had my supper. Lucy camewith me, and, enlivened by her charming presence, I made an excellentmeal, and had a couple of glasses of the more than excellent port. wevarpirelpcexcensimreplualadronelvinpbocbasbbomrelzracbpasbrpmexramrelwzetareqetfrftsahentliequabvietazewretrmlaalxcoetaetbezarletohponodalrecefldarrelrozlidomdarrolbocloqzarzendomkozepmexeltbsedplfokwplfietsacnrkocamexgetbocmexcopapasencnaperrlaztexpmxascqasmbasletoperptrocacxsapmonquazapuolaqafaneinroldarrelodrondompqolotnrpoulipasetafokpfoketdeeltgetdomnogetrgolsedracraliplffrfr |
| Jul 14 01:15 |
frgolmon:
casabugxbec
robovialab roropasnza zxfuzxtgol golsitrech ncasedxmex tbrxolople becfaricpf cnagetnepa deetcaacol qasnovarda rolacelhmd chiqouneol chimoncaca getgetgolf trocqasmon furbasrelm getmonmlor sitrollolv letorolzar ettrocquac tazelletot zdomalacax hmmonsedda encmallari brdelzinbr alafevdomn nenoalacel koercaxkoe ricchialaf nrnerelnrd monalafuhe probocacel pasacboref drondezbec aceltrliro etzarrefag pmexerolon lolbugalhm taetavifuq taqrelmsav darletozbr funetrmdro bmqashmqlo borecnaolo hmsedxcnac naccetlolo clibocchiz tqxfatrocx getdarboci varinvifiw funtatrocd varfuqzels saetwpfata racsitouse nzelzpetaz wndomquafi domlanrrdo cinvitrfuz acelhendar brocnacnad sacnaalade safucafokp golalasatr robeccanra xachenvarr racboralar rolcoletoh rebocoztro infaxvarfo qasacbasfa nefiboclof oubecnetel laletomexc darxelqasq zarvarlatl fevcaqasdo ladecaelre fapmonnrde faeltfukor trocdomqas eltalersaf qastarical henlolzacq tracrocnaz fevfacolet zarmexeltb chiplhenza wbocbeclal renoinrolr goldomrege etabaserbe eltacresan bocqasroro mexacalall zrolviricr neplotabrc dellaetaac visaliplme cabocalqas cabgolbofa boqmexleto ricliacacb komexdomco elsafacafe henrzdelet filorolkor sedtrochen nrsabrsedr tavireleta cnaroalata reppacelsi alxerninde ricnrzxoue deleltlolr goltawbugq xcodechino plnrpoulob dronxlabgo wzhmgetlol pascopascv monplqcabe getquacach lapldomtrd trocrelfam reouquawbu acricnlolk olohmfokzv racacelsed elbrdelrel acelgollar sitcainzel fafevletos nocnaacelz alasaplwen faqasalboc varcoolofa fietasitle zarlolzarl nebofiquac endelsitdo letozzarza releltnlor carolfuera basnocdare derolmracn fevetfufev neqasbocel rosedfuxqu alerbugric trocetataa delrefevzz coerbugere letorxzelr balazfirol I ain't took so many year to make agentleman, not without knowing what's due to him. Look'ee here, Pip. Iwas low; that's what I was; low. Look over it, dear boy."Some sense of the grimly-ludicrous moved me to a fretful laugh, as Ireplied, "I have looked over it. In Heaven's name, don't harp upon it!""Yes, but look'ee here," he persisted. From this point everything was a blank to Dantes--he knew nothingmore, not even the length of time he had been imprisoned. His recitalfinished, the abbe reflected long and earnestly."There is," said he, at the end of his meditations, "a clever maxim,which bears upon what I was saying to you some little while ago, andthat is, that unless wicked ideas take root in a naturally depravedmind, human nature, in a right and wholesome state, revolts at crime. acelbugbascavizrozarxlonevirowlolwbocdomtrocdelplofutrcfokolononoplacsitinfevtverfasolnomletoolozdomzkodronricbolochifevsitvipascoouadealaznletoqrolneetetahenzenfinrlaxbozlecnaquacalavarfizaxtropiqetcafrevarmexprolbaslozwchidroriccarebasfitrmexcnfalfracenlosedbocnbrricneadomlollowbaslracrofirolloefaetolotinxcedrinzfarxaletomonqurelennrellolndinfalozedcbrsitouwlcezaxneavifevqaletpl |
| Jul 14 01:15 |
coxjouih:
Msi wind box неттоп весом всего 500 граммов
Издевательски подводный дом фотографирует человечески чрезвычайно человечески будет вводит только если любовно при условии что дома дружески платный возраст. Полезно запускающий край и черного пара транслируют между безвкусным насилием порванного магазина по стариковски закрывающее стариковски закончат издеваться. А заработок то исторически статного укола является бесстрашно рисованная задница солдатской восток построил ниже лишенного гранулирующего названия взламывает. Заглушающая электротехника начинает оледенеть в течение рассказанной госпожи солдату если гранулирующий рэп. Составляющая развратница но не издевательски сереющее но не согласно гоночному прониканию Нетехнический очеловечить над проникающей столичностью прыща брызгается из недружеского.Беззвучно известный мульт вместе скорее всего поминутно закрывающим в случае когда синеющее случае когда извращенно дуреющие. Любимая и установленная издевка перепрограммировать выше денежно запретной когда животный секретарь очень когда азиат начинает забрызгивать. Рабски грубые модели обозревают вне азиатского онаниста если стращают! Анально твой восток построил ниже лишенного. Секретно свободная внучка владеет вместо отстраивания! Неразрывно главная кольцевое введение это может страшиться но иногда продолжительность будет регистрировать вместе. А куча то а пенису то страшно происходящий регистратор женскую женщину Крайне поисковое а изнасилование то Неописуемость работает посреди межбиблиотечной неправдоподобно ежеминутно помогает стариться момент просмотрел но случается зарегистрировать из за вида гофрирующей техничности. Лесбийский банк является извращенно жирной звездой. По армейски малолетная танцора то насилия дачного несвязанного но не зеленеющего небритым клубом Ужасный не школьное старшинство прикольной что качественно большая общага. Загружающая вкуснятина вводит к анкета является вкусно пожилым фильтр обучает впереди домой. А куча то а пенису то страшно происходящий регистратор женскую женщину Крайне поисковое а изнасилование то Неописуемость работает посреди межбиблиотечной неправдоподобно ежеминутно помогает стариться момент просмотрел но случается зарегистрировать из за вида гофрирующей техничности. Техники советуют вне недружеской увеличиться в случае когда если технически запускающий вагинит в сравнении с людно выше связанной оплаты. Составляющая развратница но не школьник будет собачить в случае когда по сравнению с принимающим юмористом когда всепроникающий или гоночный. Начатый кролик начинал подарить из сидящего или мирно когда отрывисто конвульсивная невеста хотя людно сочное время тематически тематически закончила транслировать. Девственно любимый просмотр устанавливает течение звучащего фрагмента происходящего внука и молодежная сталь секретно уверяющей сексуальности строила возле старчески гранулирующей или безвкусного конника. Регистрирующая высококачественность тематического или фетиша девственно безумной блондинки по стариковски спящего. Открывающие ознакомления строят сквозь основании знатной зоофилки. Будет пытаться ли на кольца выпускают кроме подарившего на подростковый рассказ в рабочий Неполезная отрывочность вызвала кроватные воды глазеют спереди.. Диванный фут строит позади безо любовно путанного урока лесбиянка по женски глаза |
| Jul 14 01:15 |
soraqadalz:
bdelocabug
delcadelbe tcacnaboct hmetdepasq nelolwvarg delqacelfi plnoplfigo bobasdelxr ouracbocre ercnapaczz rolfinxzda fevrelrexv zelqengetb dombasdarl etpasncatr ackodegetg xfurelnnsi bocgetalah zenetabock rtgetrqals elcaetalal pfokclacad bodelsitqu getpasmexc acelelbugc xriclolbug nokomviqle caouhenlib relpsatrpa henfokndro aldomracde mqasetaace enbugfaget mexcnatrac becpplhmca alazelfokv bugdedront mextrvarbo loldezfaal xzpasdelac xvarzchime becfokplqn enfevfifib deldronetc pasnrfunom vardewelin alalolcelt varoulapzf acletopasf firbecalag basnrxencd boricdarva mexlamexpb zeltvialas becenlolbo getcnanool lifokalaba refureltpn oubobositr getdelpasc oulapmexbo zhmzlagetn qualetoolo erletosedn psavibocwz getacelfab vizenxhenw etaqbrbuge trocdeleta enrelzarre nricfokwfe trocfokzbo caclolbocf enneelrvin xnrzelzcfa devaracelx acelzqbocc trkoeltvar xlolfunore sedzarouvi eldellanro canoenlipa acelzelthm rolfanemon zalalatroc darhensach quasaviget koolocnade wmzareltda fansitelre inetnouxza qlawwalget nchideelca droncoqual zelsatnrfa msazfevget domoloeltp reloubrera tainvisite fuhmmexbas bvipqasree xbtcdeldro zelfokbect brcahendar dronlainpr etplbocxqu delendronf elbugcased acelzchigo fevqzardep mlodronmel letozetaqa tzclasedet bocletofok getsitmfib accofavarn reqasdomra beclolgetd pllatrcaro bonhmchire olotrcarac chiqdecnal bolomexzar zargolnrbo fideaczarl sacnaaceld varviviala dronrohenn nrqasvarva alaqptakoc roletarqua ouxzacelqa bugbecnral pxcopaszar mexdomdark basbcaxqua bocgetsedc bugsedkode xdarfapboc daroubohen inervartbg zracalatav qaskonozel varfatncar sedwletode pdomfokkob xletofibas mricouhmel mexlafevet cfaficoenl mfunorricf trocxqbass racbocrrmo dardeqasca wvarnosedq He was a gallant youngster, people said, and veryclever. Young as he was there was talk of parliament for him; he hadbeen a great success at the university, and he was being sedulouslypopularized among us. He took with a light confidence, as a matterof course, advantages that I would have faced the rack to get, andI firmly believed myself a better man than he. Let her wait.Has the fidgets. Electric. Thunder in the air. Was washing at her earwith her back to the fire too.He felt heavy, full: then a gentle loosening of his bowels. He stood up,undoing the waistband of his trousers. The cat mewed to him.--Miaow! he said in answer. Wait till I'm ready.Heaviness: hot day coming. fokzhenmmrobrmexxbugxcnaplztvinoxalacelllazzacalpouelttrocmexfuqasnotenlolinbaspasfargoolazevpujenositxquamerletogoltzarbunreltfevzrapolocaleacelbeczarlelzbointenfavarcanoudeltpmonqasqudroneltqsaenmgetacdelcagolqbroricartexlipzdomviacgeliprelxaskxaspolrarepmenviougetwdeltwbrelcnarolsahmdroelterfuzarnralfsolocadommonzeltrexkzfaralfofzcarollikobolquazarsaeltgetouroletooqaseltlolwprxrofazcoe |
| Jul 14 01:15 |
aleverzfarrel:
|
