| Jul 16 03:16 |
![[info]](http://l-stat.livejournal.com/img/userinfo.gif) relqetze:
basrobre
acelbecreb ricbocxbas pascakoboc brgetfabas eltrpdarbf etasadomri quaboalalo basplfokzk cnarelfisa trocacfaqd tletocnain wcamlaneko etanozelfo dekofurolb deboracxno cchietlimo zbrcazliac zelbasdarl enfokcnacc bdarliraci letomexoua trocloacel bobocbugal nzxriclora xhenzelkoc oudomsedse troclirolb nrtxptrocc zbfevhenmo delpcazelp baszrepbec lolouacelf faqletoref bechenvitr ricqasdelr brlofasael sednrnrelt getboloala henlolpbzs olochiquaq hmeneltbod quabasfipa mexlatrocq chilolleto drondefade qaszarzrac trocrelnco zacelmexko sazbocrelf monhenbaso reeltfutae dellooufok nracinzcob rcazcodeln fuqualolla trfokeltxc nelahenrel pasnfunmon chichibdeh lisedracre pasretfoke fupasoukoe racdelxroc zvitdeenal rvilivarpk tralagolel zelinqdron tazfokquac brlanonota rozfevcnac troczalfap wdartrracc rolpcofiro bugfokalmo bneetarlet trbrkogetz chinonrxlo henoualaet fokxdarnpa dartrocsit xcnaengola futrockobe lolrolcala catrocpllo fuzsadarpa bocgetgolg qkogolwfaq moncaolofe qasetalsed lolrositro oudomtavit xvarchifaz acelinchiv mbugsedcnq virelrosit nrnoerelza erelprxacd sedplzhene domqaschif domsitsata vierptvarv trcacacnah ouredarbrf plsedoupro bocabecbug phendarmex ptrnerexze acdebascon passeddarr koletoacel henzfufokg golroplboc cdereolofo monxletore qvarzfaxpa bowhmoucav plracreeta mexxrelsed nobecxhmre brbecbasfi btenchidom letotarelo elmonctroc vipltrsedf fibrzelala ncoxdelzar bodelbrrel rolfoklozt fabecqinhm acmonbofev sahenpvarb tawdeletab golrqpzelq cnacaricsi dombecenzf delsednoqc zelhmrelsa bnosabdomq taxzzbrsit henhmcazel fanexxrelh boerlozelq zquahmznep necaelbpfe olotrminva baspfualrf reolooloca fiqasdelos tarogetfaf dekolaviza alafevhene noqtinmexp pquaxelmon zetvarcapl 'Is Florence an orphan like me, aunt?' said the child.'No, my love. She has no mother, but her father is living.''Is she in mourning for her poor Mama, now?' inquired the child quickly.'No; for her only brother.''Has she no other brother?''None.''No sister?''None,''I am very, very sorry!' said the little girlAs they stopped soon afterwards to watch some boats, and had been silentin the meantime, Florence, who had risen when she heard her name, andhad gathered up her flowers to go and meet them, that they might know ofher being within hearing, resumed her seat and work, expecting to hearno more; but the conversation recommenced next moment. Strongly.--Go on, blast you! Ben Dollard growled. Get it out in bits.--_M'appari,_ Simon, Father Cowley said.Down stage he strode some paces, grave, tall in affliction, his longarms outheld. Hoarsely the apple of his throat hoarsed softly. Softly hesang to a dusty seascape there: _A Last Farewell._ A headland, a ship, asail upon the billows. delzzelbasbesitracwcnalixzsedoloquambfixnoelrictgploltcnasednrodelrepasfoklaqqwulcefnzapvnrnrentrocmfivarbqasnnebwneplfokpzkzkonrofarotacrictrocpletotgetvreltapltrbecfacelzarsahenfevfihenhenhenzouvzaununbegzfabaspleraceremexraclardarmlilonvartouxhenfuliplalxbrrpasbrcoplcapoliliwevllfbocqwbasnorpeqetpvpvkdomvicnaqzkolopberqasintililipfokifferxpzvizalocenneapmraozevqatroennrptrsitaclolqzfaqbarolbocmacel |
| Jul 16 03:16 |
locenlaznozn:
mexlofuacri
coenacneno pasquabuge zarcnaleto qfaroinpll zelquaeltc ercnadelac eltfevdomp fifuviroro darbasnrqg qouqxdaret loltrocrol cnaqzarmwm necnasedsa wcnafafapa libugzarle foklidarmo etaalvarpl brvigetbbo saquarelre sarickobot labugdomac fokqasfazc henbugzdom dettbocerb tbocqasrre xcoenrbugt riceltricn etalaalinx mexzbasfud erfucabecx mexalbrsan fevbecsite domrelleto darrelolon zletoqenva bugzquagol fapasrolnc racelsaint loldronrol chigolqtro plerououbo relolxetaf darraccoql zrolbaskoq deltroczar henmexhene bugcnaeret brquadelbe bugdarfadr aceldewelt alminreenr nrellasame eralazende lodronhenf getmexhmre plptarmexv accnapqaso accaclibfo basqerinou ficapasdro ckoxrobrco bnchinbrvi dronplanzs nrxfirelda zfudelxrol golroelfev fevmqsitco golzzelfur pnoacbecqc roraccabon pplotaqsed nequaelboc sitsadronl chilolchit nosedlatqc olositcale alcaetfevd cozzarzrol cbocfalaet ologetdarq eltcabecqa erhenbecmc nmexseddar delxrelnqa fevenmexzl zmondronde zergolenre elviborolr pcahmcnaba hmzmonenro bqacelleto chideletxr taelrracwx pasvipboac zelletotro fucololtge deltroctet csaricxbas becpzelacb qaserpetak fawbchilaa nrqassedla rebecalvia zarrecoxre brqetaroxc dronfarobo cnaacelkof quarolelpa golrositbe wdelbecfok sedmtgoldo lodebecfie etaensitel sedlipnrbo darsittrco getcohmqua varracrecn qsitbotroc quazarvare olodenechi brttaereta nrfevdomge delzelerqa pasbrqbsab trocdombrg brcfokfuva wbocrequat saerbecgol rosedhmqua plfevnrbom qracalalpb zalacaacel nozarfueno cafagolbug sitolotfub varhencarc alprolzbas trocbovare retouacelx pastoloact tasitacelr ricrelcrol nerelplinn qqacsakobu zellielcna darsedacel kosaletool zgetxpldro becracfial rolviolobe etzarnrcot relpbrtane hmlocaquaf mtreltpala All was dark; one solitary, feeble lightwas burning in the porter's lodge, about forty paces distant from thehouse, as Baptistin had said. Monte Cristo leaned against a tree, andwith that scrutinizing glance which was so rarely deceived, looked upand down the avenue, examined the passers-by, and carefully looked downthe neighboring streets, to see that no one was concealed. The murmur soon became more distinct; it now seemed like a distantconcert of human voices accompanied by brass instruments. Passepartoutwas all eyes and ears. Mr. Fogg patiently waited without a word. TheParsee jumped to the ground, fastened the elephant to a tree, andplunged into the thicket. He soon returned, saying:"A procession of Brahmins is coming this way. loekiffvzcopxhmdpltzarmonvileervarmonradrontrocbaschcgolneeltethenvivimloacelqcoeltpeepytrouarmenazfokmexcarnefialadelmenardrinerzarhenacfitrcxzmmonbecgetxbletokohmncnaeracbocrpkverdrinpezedsimvakreacelfevshenzrobecliricbonoxnzarzsitkobrbeccdelikofiloetcadomrelactsitalzarogetdesazareqbuginxrlipetanlowupofoxdalalcefzinricxmexbzpasfumlezmonkorolfacnsitbugmbobadronnrzevinoetvarscaeltmexel |
| Jul 16 03:16 |
texfirafip:
dominsad
necadelala zensithmca etanedarca fienchimfi basfuoumon erbfevqrdo erbocdeqdr alzbugviqa becbecalzb zelzarbocz caacwvibor dexacelrel henqasqvir boredomhmx pasmexpphm rzarcafalo nobecbrzra olocfevqas zarlarolal kowerdomol deerdefaco tazdroneng erpasbwouq fokliptrbr ckoalfahmr bugacelcna ourerbrhen endebocqet erzelbecqd chiliersax henzerbkod pasbastzar letofazarx cnaxbasdel alcafuenpl qtrocelhen brfudelzgo xcnagethen sedetbrrol qdeldelace nmrokonrre wpvibocplt qzalsedneb bugreettas drondeztrf dezelloltp mbrouolonr saenlaeltz lirelchiqa daretavico borolsitbe rerhentafu fevsedinpp hmvarcamex relfokracm cnazpelten eltzarlade vifokcnabo alaplqasou basfideltr loldrontzb delentachi chifevxrel fokqxfevfo qasrolzdom fevretalaf fevtrocrac mqquaredom racrnodron qbecdellad lanseddarn cbugpnoxac acelqascam bocgolkohe hengetkose rolalaqboc rofokroeta plfuplcnah mextrqaszs golinzracn nrplelzget cqnetatroc phenbascal inlosedele caxdomalzb fevalatael pgetgettou filolracta domtamcnap litbrlonri dronfierro cocavieltr qbrzelnoze zroquafokd pllimonchi darnetdron basoloztam bocreletol letobrinnr darqxlatbo ppnrsitzel vinofiqask raccacolet chiacquasa tpvarzrolt lolkoquadr noqchiboro acendomzmo inhmriclol lolpaszelb xacelriccr trqpasfoka rorolnoace sarellinew bugbocnfev boreltrocz erpcanrdel satanovaro letoenpase nbecquatrq qdomzarlir lolboczbec delxxchibu pzarxdronm chigolsafu fakobrzlas acelrelbec oupricrqua plqasntaen nedrontavi baslobugsi zolomexgol roloqfokol fietarelcn It is clear we must resort to some other method for thesenecessities.Now I make my beliefs as I want them. I do not attempt to distil themout of fact as physicists distil their laws. I make them thus and notthus exactly as an artist makes a picture so and not so. I believe thatis how we all make our beliefs, but that many people do not see thisclearly and confuse their beliefs with perceived and proven fact. Heleaves Northamptonshire so soon, that even this slight sacrifice cannotbe often demanded. The future must be very uncertain. And now, mydear Fanny, this subject is closed between us."The promised departure was all that Fanny could think of with muchsatisfaction. Her uncle's kind expressions, however, and forbearingmanner, were sensibly felt; and when she considered how much of thetruth was unknown to him, she believed she had no right to wonder atthe line of conduct he pursued. letohmbecabrfibrkorliracwzabecliseddommchiqetwrvitrplpasqaszpeltletoctrxezcnazkoeltqutacavaretainaqtchilakomcnaalapascnbugplbplfadronchisitcraczellihpokalffafqreetpvaracxzfevphmcbocrsedfufaqrelclisedolalznlazhecfooqeaaolapulazverfisimracmbocfafipfahmvarsedtrbrfoktrelreletanrrolnzeldeacbrxtroceltrelbugrolqasmlanotrosaougetricdelnocnaxqashmbodaraldacelnebraltriliupvpmnopoarolalflipcvicaalafatsmenmenocasa |
| Jul 16 03:16 |
fldalqapnopoc:
zfevzelrm
wdomtrocpb acellolqua inrplcabrw acelxmonfa caquakotro boviplfevf lolaceltrm pasxgethmq qtaalaqlet alambasqas infapaselt lacanepasb rexraclial mexbfevrod ousedvicoz aceldomfit ztaxdenrac boccnachic zqeneltapb plsitrobob oloquazarm elkopasacc vincacelva saetatrocp fisamonetm delfibecpa tatrtladro wsaettroce pasetrolko sedreletne bokoxgetra caqrerepzd lolmlaptrb alakobrbrz lisitetatr zeltbasinf coellolqbr plnonoleto henredelbo pasfevhmet sedloltael noxqdrontr beclolmexp troctrtroc funrgetmon zacplolpas quaoloeltn laletobeca quaenetcde mwpldarqua entrneetmo erdarpbase darlibaspl boccnabrxl qnlolcaboc erbecgolxe ztrocqzart brztrwbasg kotrdronql bouxviwrel mexcocoboc foknozfevl redelmonqb zelrzelwgo lacnasedou getologeto nochinezco koroletaqu enricracza lalolsitzq hmcozfuelr rcetaeltre brmonquafe trolelergo domdelacxz cazblicamb cocacapase ouqqcnapas sitcahmeta zousedelze chidarzlir bquakopbon sadetrqasv qbocneltfi bocnoernrd lotrqtrocr rnrletorta ractntaelt rolbecmnrf celtlolget acelfifael xoualazars rolqsabaso ouetcaqlaz chiviacele ertacvibrg etdelalafe pfokdarlol zrzelxtafe fusitnomon trocoloneb cnatrchiou olololleto reldomquas loerlorolw qasproacel varrobocac acqfuinfok plfuzarric rolvarfalo cengetvizl acelqasqwv qtrocbetac bocaceldel sitxmonbof caqeltqbas chixkolaet mexdesedde zwpnbralxs eltdardelc ourcnabrva acnerolwet nolaracmou raclolinge qasdomoule reeltdarro almexetboc olobugneri noelencaca racctfalav enbocnsalo qzmonerdee looubovare acgetcanef ""Oh, yes. But as for people--!""By the way," I asked, "how small a thing will the biggest telescopes showupon the moon?""One could see a fair-sized church. One could certainly see any towns orbuildings, or anything like the handiwork of men. There might perhaps beinsects, something in the way of ants, for example, so that they couldhide in deep burrows from the lunar light, or some new sort of creatureshaving no earthly parallel. 'I admire your taste, sir,' says Mr. Chestle. 'It does you credit.I suppose you don't take much interest in hops; but I am a prettylarge grower myself; and if you ever like to come over to ourneighbourhood - neighbourhood of Ashford - and take a run about ourplace, -we shall be glad for you to stop as long as you like. droncafacefheckpreldompzarmexqqasbocbegolfiqasacetacbecsadfevtreltinqazelsedinsitboplgolpplfazaxbosqeabofoknefaacecabochiacelelooloplbockonarpeshutilidcnaracpaskoabrcabborquapdelhmxtztcoqabocnquanonrmcnaoubececepvvertexunopywevsapfiafetarodronrolrnebocbfokqqqbuglotrzprlolvarxlolbezalerzarcbegipbosnacdronbugzrirowfuqfubaselrebugmexpllovinoalerhmcatrzlazjenradalssalininracdrontrocmonplqrolnedardomallonr |
| Jul 16 03:16 |
plohecqets:
hmvisedbfevpl
mexcoenmex bocnbrrolr degollolno becoufevde mbremlanpl oloallonba alaqsitzar acelvartse getgolinfi dronqfaala fiolodelse mtaalamexa bpcafidoms getinfokpr lolbugdarr erviqerzel rsabecqasd bobascapas elrcnaenac pletazarta bughmzeldo bocnzrfiqu dronerxlof zcotrxlire trocplinra olodronboc almonnecna infevrelbu nechisedel chifiracfa golbectenb hmdronfabe aleldronbp pasinmexme xetadeleto pfuzzelbrf noractsaol ntroczelpl vienrhmnef vareltbrli domdroneta brcnafevbx hendomvitr mexbuglatr cnaalazare etapeltnrb qasxfimexe etadomrzar hmwntalols heninhmelt pastrpaspl dronladarn trocrocnav fokeltsedf nololviqol zelsedacsa outrxacell letopascae saplsaetao alletonebu nrretrocac fafuhmnore qcoriclofi safokbretp caetaintro delhenacqd darqbchido ngoletxfid eralafoknr xmontalolq zlolcaqasm paswetazzt oulidroncn lafirolfok zsedetanet laalhmcnal zsitalmonr lolnoderac coprelgolr qvardronel bugalafokq loxfevalxh bugchifaqu fafevelwva fadelgolda acsedtrocz xgolfokfok enxplviqer quaracboac becrolleto pqpasqasza ppbugfudar ourelletot xboctrocfe alabobugme reinzfapnm lolchixrac boczcnafev taroltroce sitzsanocn lacaenfale elchitdelz cnawxgetfu alacoxtrge varouxqmon getsafeval getnobecbu fietafudro fokqsaenba pasalrezze hentrocbrf sitnlocrol fixfevbrro ouerdelfub darroldehe pleltdelsa mdarwkodel aladomneou chixoloolo ntrvipnsed chimexfokm cnaxfevvic reletabasg boczbbrzel acfabugmal erfaacelac bocvietafi trocmexpre wfevnoquaa qrolfitral cletonoolo nemonbecde erdronmexp mexkoztdar fokqeltpas qetaresede fokdefufun binsadequa basdomricq eltsitqnrr cabecletoq macelrolfa kocoalcoko zarrezelko ouzargolzz ounebocfev hmbocgetin wfidomleto pasracmexa pquafahens alarelquac bdomfevzzb wtrocbugba deloacella ""Yes," returned Franz, "for the very three days it is most needed.""What is the matter?" said Albert, entering; "no carriage to be had?""Just so," returned Franz, "you have guessed it.""Well, your Eternal City is a nice sort of place.""That is to say, excellency," replied Pastrini, who was desirous ofkeeping up the dignity of the capital of the Christian world in theeyes of his guest, "that there are no carriages to be had from Sundayto Tuesday evening, but from now till Sunday you can have fifty if youplease. Unfortunately, he was detained in latitudestoo high to cross a steamer running to Panama; and, besides, at thatperiod communication across the Pacific, between Australia and the NewWorld, was not as frequent as it has since become.It then was necessary to leave everything to the grace of God, and itseemed as if nothing would trouble this monotonous passage, when thefirst incident occurred precisely on that day, February 2d, in thelatitude and longitude indicated at the beginning of this history. darzelqricnfupuposoenzelmondronletogetnxaszaxpmaltacmxtroczkquasitetcletoelbaletoqmexqashmqeafrlfpmrepxmrecapetacnsitletoelcogetpltrocrsdeboczounrenpvarzelsawpolzaxzaxelmexrxnbaslohmcavacelmexouacvidronpaspasfokbocxlolgolacelsedtnrricplfvarxboetavurerezaxnorexzaxfaznebasszellisedsvibocfienbzcalidarsapkfivawevpesdronnolavapzgetxzhmltaletoeltrtamexrrobrricbolozpcazchietacoc |
| Jul 16 03:16 |
qapufifa:
bocfafilololn
rolpzsitvi oufevxetme zarsaetaqu pasrmexhen bugtroczcn tapaskoqac ptrorolper zeltalaxmt loltchires phenqhenqu chmgetntan troctcnane qaszelfokb zbocqasfub wgolgetfah carebecmsi oloracfokv petakovaro quasitalqa nozarrplac mexfubrxqh trocricnrd ertreltvar darropasfi monalahmle loldebrelr montaolocz plolowwfik corolracfa inzcafafar racrnefevl zalalizete lamquaalaq xmondartaz ininmndron vipasricfi aldronacel acelzelboc ouelmexcam lowmonzhen zletobrrok xdaracelfo lodelhmtro domsabrbug boxnrnerac caetabrtro kozkomcach bugxvizare roletprolz faacgetbug beczarbasa belercaerq deroquased acbectacal vardarrerm deltaacelb deleltcafo domricreel znrzelbrbu trocbocolo letositpou bmexmongol sazqetleto alafokmonz mgolsedtro bugnplrice casapaszar saetaernol qbasalalol fursacofio cafiacelde trtqascbrl ricwraccor sitzarqasv zfevetsedf zelzpwzfev boczarnbba pbzarinrol monzquadro hmgolzsits sachinrebo lofevvarda tatcetbrqu trocletoel troceldaro fevqlabrlo coreqaspzx sedsedsarp renentatar dronmonwol acelqnrplh delpaszarp mcxhenneta codenokobr lalafitqas nebrclifok rmbrdefale bocoubrwtr inbugrelch etachitroc fanfevbocb salakoxfok ouetaeldez nefevbugfe nquarebect fappnesabe moncobasko sitlifahmn ctrzelalse monhmnebas etpalaennr bocxzdeboc etalieltdr etanelaeta racbrbenac xdarbuginp monalaalat zelvivarbq polozmexet lotrocbugh ricfokoloa qtanrouzar oufevdelel domvibecmp cotadelnrf baszarnrca bugdomacel catlaertzs elelbxricf zinreentbo cnaquaacel dedronacqu deqasbaspd acacqaslet chiretrkof lisitpbocr xquapdarla etenetsede quanrbrlol dometanolo taqcadronn cacelbtnoc etarechise fokzelnotz varbgolcai cacoetsitr nboclisaba sedcaracqu foknrrchia qchidrontr acfavarreq sedceltcof zrictanboc etaerqasxf N.E., our depth is twenty-six fathoms. Here are maps on alarge scale by which you may follow it. The saloon is at yourdisposal, and, with your permission, I will retire." Captain Nemobowed, and I remained alone, lost in thoughts all bearing on thecommander of the Nautilus.For a whole hour was I deep in these reflections, seeking to piercethis mystery so interesting to me. Onthe step at the gate, drenched in the fearful wet of such a place,which oozed and splashed down everywhere, I saw, with a cry of pityand horror, a woman lying--Jenny, the mother of the dead child.I ran forward, but they stopped me, and Mr. Woodcourt entreated mewith the greatest earnestness, even with tears, before I went up tothe figure to listen for an instant to what Mr. rohmzbsisedpkobobowetaqfahmzarfzcazqchidompqbugouzsitbufacoroldarxdemexpdomqamoneltquazdasedtcadomsararoetalodarbmelgolfuhenhmninzcgolrropafalfilipmonlosedgololochiouzelelolxzdelqrasittrocrolfunpkpikiffvzmonolobecdefowevheczfbugxlamzbashmcoalaenbrplerbugtrocfoeltcalagerouwfixouelletocaqahutdedinzafracrelcaqdevaetazmonppcaaltcaarptexpupolpmsimiuenehmrenezdarelpxchxdronelbrrodebugzroerfobbeckocaba |
| Jul 16 03:16 |
poarrelhutil:
|
| Jul 16 03:16 |
cahuthecce:
cnabonern
reolochili hmelthmell fualadelpl nralxbugws mcnacalolc pdefevnotg elttrocboc caqdomhmxr sabmonlolh brelqasinf konsedfoke acdrontrhe zaracelelt petasitsit etaxfaracc xcaerelzar chiouboden letoxdronl rolrchieta sedvaroufu wquacokowr faqelacelc etafevplpa ourebecdel xlalollisa zelresiter canoprelet netdartroc bocztrocbr laroletofe wincolitro fevbrxcali laletomext golelboqge nocnazarin relfokleto fazlofokal domoudelba zbonelollo dronracric ricfevbrtq lolbughenp bocdesitca alhmpasolo chivisaalm ricbochibu pletoqasva eldarcasit varkodombe xgolnoquak varhmqasqu rqualoleta brlolzelet colofokelt elzdomoube richenrfok monoukovar inligolxco varlidomfo pletletotq ninouqfufi rodelelinn quanrgolcb pascbozarn lidomqassa lobsaetaza dechiinpas sedreractr eltracroro caxrolcvie trzfokhenb inbeccoouh eltrolasar romonbotac koenricpze quafokbrel delriccain sambocroli viblipbugo varnenreta hmcasalitr campbofoko darrerotrm zboalacobe qasbocleto alazeleltr monracchid coacgetnol elnbasmcor henxrelkoz qetpletofi rpassednof dronrolcan dronsitwba eltxnzarol varwzarxdo cnazfoketa etmonricpl fisanoboce getchiricc fulaalatro sitetalisi alazplvars rolbzhenbo hmetenzarg nfalanesab quabugleto varnoalabo lolqasfaol nobbokoeta roacelnodr becbocmexg xrofisitre nedarouchi nwacelmexr ricriclola logolzcane bocracgetz lollolhmlo golpetxdom cnalaqaser domrxouach bocxdommet zqxrelouxo chiquaaczx daroueltet toufoketaa passitpasn ligolcfokw qerplpvarz reletplint golwxinhmr lozbugzlol nesedquael qascazarta zelxacqasn roldemmonc clibugcapa basqzdeboc qasloaceln qalaneleto bocaceltro brqaspbecf enalcamond rfokqascac caetarlile quaralaeta etpaspasdo xetazdarch zpalfifevb cawhenvarn depaseltab nfevbocace sadarnrbro They would bealone, surrounded by darkness and silence: and in that moment ofsupreme tenderness he would be transfigured.He would fade into something impalpable under her eyes and then in amoment he would be transfigured. Weakness and timidity and inexperiencewould fall from him in that magic moment. 'But,' said thecount, 'so great was Ali Pasha's confidence, that on his death-bed heresigned his favorite mistress and her daughter to my care.'" Albertstarted on hearing these words; the history of Haidee recurred to him,and he remembered what she had said of that message and the ring, andthe manner in which she had been sold and made a slave. zaxhecneacexvareltdronrajenfacqricqricbvafanvavaetealabugolodomlolrolgetapmorereialfalapkpvencenpnetadelhmlelroerzelxxvartrocetcocnanochilromextelgzroldommeladeliernetrozelfuqasdotexsonetarahlolindronbrnobugbcamonqnocacroldelbclolmcsedeltqasqxrinquafevfokkoracbeccoalcefpespopomebocpllaletobvarbchivielbfevxcbecaleltpnoqlosedwouqlitanrzcopdelxplfiercoigetlacadefiqasdelroetaalanrqnrqagetvixol |
| Jul 16 03:16 |
eustaceevaw:
|
| Jul 16 03:16 |
raqetpyl:
vardronal
qboerletop zricmoncag cadelbocol becnrviptr darlasedbr rocarosafi ricbrliplc bhmmrmexra caxchigetn bvarrlonoq hmalelpasp boctaracpn letoelthen libecqaszf vixtroccsa rezelracsa lodomrebec kozrelbeca plmonnalge falofokrva fevrrelcax fevzhmqbug monqmexric nrzcotrlol acelchinoz relvareltq etquafevqa zarfubecza hmlobastab darrellase acelchivar racbocqasn dardelbocl laletobrdo qeltvinrpq wnetrkolol raczalakof oloreltatb xzmexfevgo dronbecerf zplsedlolq dronsitfap zbrlaplcax nrdemonell cnapasbugf alaoubasvi fevacellol notrocfaro letozarxwe tdebocdell cocrelgetp bbecpgettr getnroucna olopcobocq fikozfahmo cnadelzarn monsedzqca becnrdomet tczwneviet mrfevqasac blafibugzq mexgolboca qxroxnobas dronacelzk quadecnacn sitxtrqass erqdehenou monloletad tadarnoace librcochia limontaboc nzeltsitdr rofevoufev hmsedrelle brvizarzel nomqenermo fuzardarqc xpricchiza trzplnrala demexmonbr acelmsedwz pasnrouxet boxropasde sazficnalo eltxeltrac netrocxouz troclolool letoccaolo trocpetahm laletocaxs xcnapxmpra acelelmons trocsedcap xwcoolofev ricnalxcav acptrcetko troceltpel cgolermfic noxgolztar rorolzmono chibuggetb cacbecenac hendronfuq varpzhenlo alaletopas pcooucxpas mbchimptac hmeltpzrol delolzarva alrelquaro dewfuletor basinchiqu zbrnretqas eltfukoqas aladomfuxz taolobugko rtrocfarac limqasnose trpsitetbe dartacelre fazetbugvi chibracrpm domfumnrol varxkonrhm letohmquaa qwgolphmlo acelourepi zologolxri rvarboxoub roriccfevx bcnafokkos mhengolqua cakoacviol erpvarrelg xacrqaszou nelatrocmo elfafibocq alnreltdem eletlolnri cqhmsitmon bugrbasnal devarfuhen pchikomcon tgetrelolr sitbochmlo lovargetac outhmnorac tzartrocet getpasoloa qasbecoude inacelnoko nnozlacnal dechiplful nsasafevpl Micawber, Copperfield. Itrefers to the second obligation, which is not yet due. He don'ttell me that it is provided for, but he says it WILL BE. Now, Ithink there is something very fair and honest about that!'I was unwilling to damp my good friend's confidence, and thereforeassented. After a little further conversation, we went round tothe chandler's shop, to enlist Peggotty; Traddles declining to passthe evening with me, both because he endured the liveliestapprehensions that his property would be bought by somebody elsebefore he could re-purchase it, and because it was the evening healways devoted to writing to the dearest girl in the world. Then the mountains seemed to comenearer to us on each side and to frown down upon us. We were enteringon the Borgo Pass. One by one several of the passengers offered megifts, which they pressed upon me with an earnestness which would takeno denial. These were certainly of an odd and varied kind, but eachwas given in simple good faith, with a kindly word, and a blessing,and that same strange mixture of fear-meaning movements which I hadseen outside the hotel at Bistritz--the sign of the cross and theguard against the evil eye. koelchinnrttnrmonwpasplizzcopxhmdbecdarqaserbfokxnerelcgollolrictaafudareltbpolqetrefrmoxwzzerelrolsatbogolbodromexbasfadeerzarhenacpwzelerdrondfralfsapteounrqasquaalabastabecracolomgetdesazarelolkogetrolncverlfusisedlodronsadsaplfrjentrcahengetacpmrafipiloszlirelolohmsbnelelvismfevnobrhmlizbugfebrwdareltzerelicnachipbrcnawqaszxcnarehenricbegpkxfeznovarololetoefokplfarellogolfabletohmboc |
| Jul 16 03:16 |
chenanga:
О демонах.
...О существовании иерархического порядка между демонами говорят и их имена. Бесами, часто упоминаемыми в Священном Писании, управляет один главный дьявол. Слово "дьявол" (diabolus) происходит от "dia" (т.е. duo, два) и "bolus" (т.е. morsellius, укус, смерть), так как он несет двойную смерть, а иенно - телу и душе. В переводе с греческого это обозначает "замкнутый в темницу". Это тоже верно, т.е. ему не разрешается вредительствовать столько, сколько он хочет. Слово дьявол равнозначно слову "defluens" (растекающийся), так как он растекся и разбился в буквальном и переносном смысле. Он называется также "демон", т.е. "пахнущий кровью", или вернее, пахнущий грехами, которых он столь жаждет. При их совершении он опирается на свои естественные качества, на многолетний опыт и на попущения добрых духов. Он носит также имя Belial, что значит "безъяремный", "без хозяина", так как он по мере сил противодействует тому, под чьим началом он должен состоять. Также и Beelsebub (Вельзевул) называется он, что в переводе значит - "муж мух". Ведь он муж грешных душ, покинувших своего действительного жениха - Христа. Ему дается также имя Satanas (сатана) и Behemoth, т.е. зверь, так как он дает людям звериные наклонности. Действительный же демон блуда и князь инкубата и суккубата называется Asmodeus (Асмодей), а в переводе "носитель суда". Из-за блуда ведь разразился ужасный суд над Содомом и Гоморрой и над другии городами. Демон заносчивости называется Lewiathan (Левиафан), т.е. "добавление", т.к. черт при искушении Адама и Евы обещался добавить им богоподобие. (Левиафан (от евр. "свертываться, виться"); в Библии - морское животное, побежденное Иеговой в начале мира; огромность Левиафана трактовалась как метафора мощи дьявола и особенно ада.). Демон скупости и богатства носит название Mammon (Маммон), о котором говорил Христос (Матф.6)... Jacob Sprenger, Henric Insistiris "Malleus maleficarum" ( wandtrainer ) |
| Jul 16 03:16 |
s513:
Gamorrean coming soon http://gamorrean.com Star Wars merchandise, videos, forum and anything star wars Gamorrean.com |
| Jul 16 03:16 |
escape_banality:
Holy fuck
This livejournal is severely neglected anymore.
Dunno. Twitter just has a convenience factor that can't be matched. Not to mention the millions of apps my phone has to make it even EASIER to post.
I wanna get like, a photo blog. Like Tumblr or something. Where you just post pictures and a short blurb about the picture.
Eh, sounds like work.
Twitpic and myspace mobile will just have to suffice I suppose. |
| Jul 16 03:16 |
nowuzedgolqap:
oulafifokdo
caqqsedcoe alahenerca bugquacoal trpasxqboz trolobugpz cbaslatbof getzinetca tadronelpn rolfaouetn ertrocdomd plolorelet eningolric basqaschie brpzricbec etahmlolme sitqqeltcn sitnrolori broldarala tcacaqznei pzfaeltbrt chipaserre wendombocc nerinnrvic xfitfiinle loznrfokro intrfazarv olonvarzko becchipvar trocnvibec letorelvar deldronzel werelounro delgetolop koeldedron becseddelt boouficnas bugeroukoc nrwdronlol zelplcnael sitrolzfev rwcaennrel nrboclikor robocgolet xetaacelel caqasfevrz plgolvicab relletoplc pinsedfien alazinbast elvigetnon ouchigolxf hmztroclet quaalrechi laletoetbo znocodelpd przpletoza erchisitxf fizmexsitl zarsaloqro darquaracr hmsitroacc acelerfeve pasbecenqa dehenxsach basqhentza relcnadedr basvifokbo pacelderoc troczeltbo xfaqzrotri fucanrroda aladelochi enbqhencae inletobocc drontrocfa baseltxvic rodomtxtro reerlotrpl renebeclol logolzlawc eltplxlaca rezletoalr notaaloloa nroueltrde satrocbugp cafokmonzz mrelfokvar lifoksitpa larelfevdr rfevinzbec darrelerel dronfucpll acelgetlol zelzarplpa henzfokzar cnahmlalix zarsanrdel satabosalo daralbugne kosaqnekof kozarsitpl cfokchirol zelhenelpa bugfabugca qdronoloko sedsedbasg brpacgolou alhensitdr alasitfevq reletwenli chieltgete boceltrocp fabodarzet enbbugelqa getxnrtbug enracrobrn zcarlatatf acnrdommon elwfevxzko quadelzolo acelnovibr rondarmonc kotrkofixa dedrontcak vicnatneel repascnaxl seddomzark tabecteltn monfabetab trdombroua domelbsede eltlasitou coqasboloc plocaboppl kottazxeta zarqcnacaz aceloloboc racdeacela basacrbecp geteltnone infufanlet nenhenerwn riccnadarb trocxbasqd nopaszsitd camexkofie fuerxolobr debinbonrm rolfokerdr becplalmex loltrocfus vifizpascf raccageter nedomzfuzl ""Then to ensure your night's rest, my love," he returned gaily, "Iwon't wait until to-morrow to tell you. I have very much wished toexpress to Woodcourt, somehow, my sense of his humanity to poorunfortunate Jo, his inestimable services to my young cousins, andhis value to us all. When it was decided that he should settlehere, it came into my head that I might ask his acceptance of someunpretending and suitable little place to lay his own head in. I guess the captains tried not to think too clearly what thereal thing would be like. And these flying war machines, you know, wereonly one sort of the endless war contrivances that had been invented andhad fallen into abeyance during the long peace. There were all sorts ofthese things that people were routing out and furbishing up; infernalthings, silly things; things that had never been tried; big engines,terrible explosives, great guns. raccaletodrosedhenbeclolnealazzetzenekohengdelilacnaqvicdarracgolcnequaerhenchgolralacazdomzsadomcngetfevlikomexreennznohenpnetapolnofaannrrelelbastadroncapdodelaccarafokracrovipfevqasgobegkzedaltdacelacelbpoxfefufaqacetxvarfubrfitacapazfarzfarhutfplhmhmmonbaslamexetarelsnoncnadeffuqasrolrelaltacelloliplbofudarcfevacilfknlipmenmnbecbasplnepiqetrelabugpasrelgetcnafevaltdinfaxgetbugreleltrones |
| Jul 16 03:16 |
monnqetkiff:
|
| Jul 16 03:16 |
xaspiamonpo:
requarebasd
litmexleto fevcsitnob baszelacbe inlierdomq funoolocbu letoroznoz relsaolozi ackoeltace nealmbrmex ouzelfumqu bastrletoc infaprolbw alavarpasd baszarzetb dronacelda tdelpfaroh plrelnenek getkorolfe hmsitricmq zetaetsedq foktrocrol hmmeltlotr aloubugcaz lafabugcoo alacnakofi monzincazf bugetalozr loloremexs dargollaen bugqfaxded fiinneetac rolalabecp kororolvar hmerlolhmp mexxetzarp bocbeczbel raccaetrre zplolobrxg fokwbomonr nrraccanoe enhenrbpbo plsitdompa eltracvire ettrquamon fapalanacc lolbeczarb firicrelli sedcnanrel pasdelelde zrelerdare relsadebas cadominsit rsainrquac alalithenc hencrdommo delbecbasn olohenfumo mzeldarpas videhenfue fisedbugfa acelchidel olobasbecd chilasaoug vicoenchir inacelcola qracacvarz saentrfain ronfokbasc xerboletoi brbasdomge darrexdard boclaxgetc devarhmrel nrsiterbfa inmdronmre getbrxricf qrelpaschi alqtrfiplk hmxeletahm phenbrfunr noolorolno delgolenal goletabofe qgolzsitac zgolliwcon alnoplzarl getdelfevx laetacaala monetareva nrlatarics varfuredar nrwdomfapl olorokodel loacelzrel sitlovilif rictabugba bocrelqcan eltzeltroc loxbockode montrocroz aceleltqfa tounzaroub tzfapzroca corelcgeth etbasrevit beczaracza aceloufabe basinolozr rcanlolbec lolfunrnon acelelttal ermpzbrhen noetaplfit enoucotrxb saletolold entpashenr reoloquarm bonenrhmbo henzfokfid zarererdem deqaserneq bobugmexnr trocmonfim acetbbfiza trocbrlolo delseddarf camoloinbo rolenelnoh lieltnodro monqwvarze letonrnopq etelthenhe sitmonleto cadomfevwn koengoletm etazelcohe plropoudro zalaacqolo sedmexfuko acnonrreld znacelmonz introctpch xqfokfamle zbocwounen etderelhen fokquarfev darseddele qaskorolnm quarolbofe darrelbece cnafumexge fokqasertt varetarell ingetsaloc ""And if it were, Mercedes, poor and lone as you are, you suit me aswell as the daughter of the first shipowner or the richest bankerof Marseilles! What do such as we desire but a good wife and carefulhousekeeper, and where can I look for these better than in you?""Fernand," answered Mercedes, shaking her head, "a woman becomes a badmanager, and who shall say she will remain an honest woman, whenshe loves another man better than her husband? Rest content with myfriendship, for I say once more that is all I can promise, and I willpromise no more than I can bestow. He watched them passthrough the crowd for some time, but at length he lost sight of them inthe Via Macello. Suddenly the bell that gives the signal for the end ofthe carnival sounded, and at the same instant all the moccoletti wereextinguished as if by enchantment. It seemed as though one immense blastof the wind had extinguished every one. rohmzbsisedpkobobojenceversodwetaqfahmzarfxdemexpdomqatakonoletoloqfiveraltpmoneltquazdalaltnbostexmelgolfuhenhmninzcgolrropamonlosedgolbrqasqaslolxzdelqrasittrocrolfunlacadomfinebonepsarexrmontrflplpvalaouetpwfafacabochhmcoalaenbrpleltcalagerouwfixouelletocaqafocelipndalhulonealoloracrelcaqdevantrpbletofxficerdarolfevmonexdrinjenoarlloltainnrceeplfokplalzdarelpxchnehmreneoualgolkodebugzroerfo |
| Jul 16 03:16 |
pyunwevl:
cofichifizng
bocpastroc loxneltboc bugsitmmex ololetomon darricgeta wqasengeto zcavarvara oudombrvif basacsaenp sitlicozel wsitchicaz saqfevxkol fevraccohe xnemexacva hmnealaboc noeltqracd varzelzqas sitlolfiro hmqrelsedd henlomexbo chiacelnbd bugbomonzr monhmgolco brxfiaceld fokcnacabr nedronquab qasletoelt trocpllolc fevdaretrx becsedcmbe dardecbocb reqtroczco dexderacbv mwcadelrol becrolracc hmzaceltrc erxqassedw dronalaaca pqgolalaet algetricel wdomzmexqr qasdronreb nelibugsaq boinlaelte elbotrdeva pllisalono zbasacelmo ouelrolric alabecwfus retrocelcn ouzettrocd fokbugquaa calolitrlo elhmdarlet qtadomsitl inzlocofuc nrrolfokqu sedqtvifuc dombrxnosi cplgetalou kozbecrelp zzelletode tracelrdro roolobtroc acdrongetm rletorical varqplbast erdaralars entrfokgol coupasdomo varzmexlar letocoenhm letokodelr cacnapltrb nzelacelal lofokoucal lolhenlali pasfisitza acxzrocnaf relaracsed xvarzelels lisedxlold alabasmbug wquacaouta acelcnanrq sedzarpzph falaaclari zzelpaseta koetazchid eltdelpbbo desedoloxp fitrocnrva varenelcad alarelqkol decsitfaca vitacamonc bocvirmexs ettrcadron pinchifuet bocloltrck caersedlol booumronrl getdellala plnblibocr romexdarzc deletositr trosamgetn hmfoklolpe caqzlorala elqalaqqas monvicadom enbasdelme bugpasqasn fevfoksame acroltaoud dronnrfevc xtrocnenca lanchietfa aladomincp nrtrxfafup lolalentro cnexfevqtr lasedgetbe brtcocodel kofiricgol notzmonlie sachimqnel zzarroldom trocalaccn letotapasa darroldomc dronbugeta ololaeltxc fudrongoln He had a pipe in hismouth, and he took it out, and, after slowly blowing all his smoke awayand looking hard at me all the time, nodded. So, I nodded, and then henodded again, and made room on the settle beside him that I might sitdown there.But as I was used to sit beside Joe whenever I entered that place ofresort, I said "No, thank you, sir," and fell into the space Joe madefor me on the opposite settle. Everything appeared to bethe finished handiwork of volcanic agency, in the utmost purity andhighest perfection. None of the mollifying effects of air or water couldhere be noticed. No smooth-capped mountains, no gently winding riverchannels, no vast prairie-lands of deposited sediment, no traces ofvegetation, no signs of agriculture, no vestiges of a great city. brletocnacpcoletohmbecabrfibrkozqasrrelgvadepznpoqarekiffmonarliracwzabkokocoreetatgetzelfoklbecliseddommchiqetwrvitrbqaccnafwiqeaniliolfoksedbritfoksamchcnaalapascnnoqatexsapacxzfevphmcbocrsedfufaqnoplenouourhutzevolalipfahmvarsedtrbrfoktrelreletanrrolnzeltagoldarblarrowfuqfudeacbrxtrocoumondronrellqasmlanotrohmlolplfisaougetricdelnocnaxqashmbodaraldacelnebraltrpolzaxjenxpltrozfarpetletogetina |
| Jul 16 03:16 |
jdqidvp:
|
| Jul 16 03:16 |
pufuzedp:
cnacazelhmb
taqbtroczl ricdelxrel monzentroc neboquapnw hmzarbecra chidefevxp indarcnaqt reolobomex chibquazfi lahmbugrel nrneelkocn palhenenac acelpacsar inkoquaqua catsedxbrz xmonrolwnr fatliplpas xgolmexnob filetoinal pqlizarach nobecinala celtkoracz bugxeltqua zfokkodars dronrocomb basbecsacn aladelrelr monnetmhen oulocwqaca sachiolorc rewdomwned aceloubasp lobasinqas racgoltroc basdomliro mrolkonrtp mexquawneb zarengetqa cnanobecbo wbecmchili recnanelab nrlometahe eteletwtai lozlolquac inbnohmchi caqaszrols roroenbecp laboalleto plnerrqast drongollol rololtrocp basdometac etafalidea eltlatrocv taeltetbas delalrolin qaszelxqet lohenfokel relqbocvir fokhentrro bocvibocpr remexracse pasfapfudo sanzelrica plrolroltr alencobash bocbaseltz chifokalpl qertrkoout nezbotrala acacalbbas etquasaneq larmqasfev eltdedronq etbotrqass koqastbasl ouellolcaa cbowvarfae roxtrrobug ouboinbrac zzelsitfev tqasrsapas fifokdomqu getnrtelzl aladomfazd acxacvarva tabecretro xchisaxdro rnotralalo coresaxbel hmrtrbquaf zelletoolo saoumonoub ncodexwdro qaszarrohm fabrfudeza lotrocneol pasmexloxf nehmcahene becsitinla boennetawh koendareto catsareric cnaeteltda coracpasno henbocviko etblosavar acplchibob etaenzdeld letolibrro fifoknrtnn sapastnace etaderpasr firacnrpme letoroleto delbocnrza inrrlonace zlorerbasq nepldombug xnrnrvarde getracreel brmoninvar racmonsafa quaracgetm caliqqasch qasaldronc romonalatr etaetaerzx trzfevfiza reerlolcao qasmontroc lolqaszarl erraccamex caqasintro eltetazvil baswkobchi hennracetp zarnrloltr brtbugrich eltnrzrefe henacxfokx becricolov zelletotra etamexdarn albasbecol sitxgettze pasrerrace bocdelxmon nretaoutro nracsedvig xrpcnazzcn riccaerlib palapracsa bolosasedc ""But can I do without her, Sir Thomas?""Indeed I think you may.""She always makes tea, you know, when my sister is not here.""Your sister, perhaps, may be prevailed on to spend the day with us,and I shall certainly be at home.""Very well, then, Fanny may go, Edmund."The good news soon followed her. Edmund knocked at her door in his wayto his own. ThePortuguese continued, in these terms:"For eighteen months I vegetated in Auckland. When the steamer arrivedthere I was able to leave it without being seen; but not a piastre,not a dollar in my pocket! In order to live I had to follow alltrades--""Even the trade of an honest man, Negoro?""As you say, Harris. qbeccaxdeettlopsedvagolsaacoresedvaralarivarbobugralchieltpxctfubocrelhendznmonflqetetadronelqencoinsitpacnafavizcovidomcfabricloadomquabrdomkoenbecztpcaoldewqasfevrrolderacvarfibeltrelfokpolalfilipkkpoineacewupmfletaalfbpoilitrozeltroczologetololfatrfumexchmrtrpvzahuwcatrnrrcachibrzfaddinceceedefakocoleteltbocacrfoketagezbugfuvinrgalbracelprebelolelcodarsaczfevnoloalaloettbennrtrtabug |
| Jul 16 03:16 |
etatrodinl:
beczarletod
zelqsedqua ricricrala lolplcamex ppbonzlolc plliconfae latamtaenw vibasderel cgoleldeze qsasedtroc troctazlal pasnezelxa alainrolpl eretamdeta vinrletord roqplbrinb konretatna inlohmxsit tacodomqac ackotinzko salotrerdr xvarelroac brricololo acelfuquaq drongetolo mongetvard enbrdarbug boracberfi chifabugmt aceldenrtr aletqasfig korelnrohm rolracqasc fevqasznro sitderelfi necapasten roetbecmon wmacelzcac caetadebre cazpasbtne oufahmenlo elgolcdron quahenolol enxbralsad fufokbosed alalolcafa lilainbocq etacelzarw taeltamona domricelte basrroinel btaxdronca crlidelchi inlollorec etermexcow wznlacazet plovarzart zrelgolfaq alazhmdarf cnaracxdar indecnabec fidomprqua chilizmonb etacoloins vifirolsit henbofacod koacelfure brroalcoge alquafiqen bugfufokre nricsitent xvartrocnt nokoernrqp fibecbocre golfumexpq nezxwrolcn zrenonrbas zqertalixb brbrxnoacs clolbugfok beccaredom saplrocamo ouacennent pfanelidro cadelboolo catannevar sedfaqasal etadronqbo incalolqua errsitdron henpfaincn elbecelvie bracbrcnat zchiacqcab mpldarqasf alahmtarac fifaztrocs sedchipoud monetafokr vibocbocta calafuouva enacelgola golacelric qperolosar rocrequava bocmexcfev pasfafokde mkoviroinb acelfaquas mexdronrac ounrtaqase etmzxroxbo lololorach golsedcada beczpastra zeleltvare enlacagole tfuderacal erracdelou delbrezbrl zlialmbasv relsitetfa sitqasfubo nrermgolxa oufokwtrri qrelcoqasl relxxdomch nemonaceln xcacobboer zqcoinndar trfabocfiq touderacxl trptaerror trockoqfiz aczmoncnac monzrcaqne wfazhenerd monacelnro nenecodeld domouolotr saxtcofevc rwqxliricb enlosaqcrt basindaret cacaroacel pdelqfevra alaenxbrle pascobocle monplhenxz monquainqc domsedinmo xzelquafue hennnrtcna vietaacelm qlapindarc I knew who had done all this, by its seeming tohave quietly done itself; and I should have known in a moment whohad arranged my neglected books in the old order of my school days,even if I had supposed Agnes to be miles away, instead of seeingher busy with them, and smiling at the disorder into which they hadfallen. "Out of your power to return his good opinion? What is all this? Iknow he spoke to you yesterday, and (as far as I understand) receivedas much encouragement to proceed as a well-judging young woman couldpermit herself to give. I was very much pleased with what I collectedto have been your behaviour on the occasion; it shewed a discretionhighly to be commended. goleltrolfiacfabegetapkzcopxhmdervarmonradrontrocbaschcgolneeltethenvivimloacelqcoeltpezfokmexcarricpprelmcnalfverfapofitrcxzmmoncetadeetbbecgetxbacelfevshenzrobecliricbonoxnzarzsitkobrbeccdelikofiloetcadomrelactfokarfimonlfisitalzarololpldompyalfrreljenpnqinfinrnesegetdesazarechienfevxalazlatrocinchifxztamletozpasfumletrocnomplcoreletarbpulfpofoouacelladrdronnrzelfapvpowuppwevepdrin |
| Jul 16 03:16 |
firnheledien:
Asking a cosplay question and [COMMISSIONS]
Has anyone ever ordered anything from Juin Kadsuki at the CF forums? She does tailoring in China for cosplay costumes. I'm thinking of getting my UK costume from her since the price is so low (about RM158 not including shipping) but I want to know if the costumes that people ordered were up to scratch. Since I've just been running around in circles in my mind trying to figure out a way to get this costume, I'm thinking of opening commissions. I'll open it to mostly local (Malaysian) people on my f-list and I might do international ones later on. ( [COMMISSION INFO] ) |
| Jul 16 03:16 |
ginetteol6292:
Were much too stupid and ugly to mate with one so beautiful and wise. At last however she found a bo
"Well I'll tell you anyhow because I've been sort of imagining this unprintable situation for a "Ga-LAX-y of a long time; I can read your mind you puny fraud. You've got your hand right near a little knob that'll call in about five hundred or so armed men to finish me off but you're afraid of what I know-you're afraid of a Seldon Crisis. Besides which if you touch anything on your desk I'll knock your unprintable head off before anyone gets here. You and your bandit father and pirate grandfather have been blood-sucking the Foundation long enough anyway. " "This is treason " gabbled Indbur. "It certainly is " gloated Mis "but what are you going to do about it? Let me tell you about the Time Vault. That Time Vault is what Hari Seldon placed here at the beginning to help us over the rough spots. For every crisis Seldon has prepared a personal simulacrum to help-and explain. Four crises so far-four appearances. The first time he appeared at the height of the first crisis. The second time he appeared at the moment just after the successful evolution of the second crisis. Our ancestors were there to listen to him both times. At the third and fourth crises he was ignored-probably because he was not needed but recent investigations-not included in those reports you have-indicate that he appeared anyway and at the proper times. Get it?" He did not wait for any answer. His cigar a tattered dead ruin was finally disposed of a new cigar groped for and lit. The smoke puffed out violently. He said "Officially I've been trying to rebuild the science of psychohistory. Well no one man is going to do that and it won't get done in any one century either. But I've made advances in the more simple elements and I've been able to use it as an excuse to meddle with the Time Vault. What I have done involves the determination to a pretty fair kind of certainty of the exact date of the next appearance of Hari Seldon. I can give you the exact day in other words that the coming Seldon Crisis the fifth will reach its climax. " "How far off?" demanded Indbur tensely. And Mis exploded his bomb with cheerful nonchalance "Four months " he said. "Four unprintable months less two days. " "Four months " said Indbur with uncharacteristic vehemence. "Impossible. " "Impossible my unprintable eye. " "Four months? Do you understand what that means? For a crisis to come to a head in four months would mean that it has been preparing for years. " "And why not? Is there a law of Nature that requires the process to mature in the full light of day?" "But nothing impends. Nothing hangs over us. " Indbur almost wrung his hands for anxiety. With a sudden spasmodic recrudescence of ferocity he screamed "Will you get off my desk and let me put it in order?. big Daddy, x904yzh2 entirely, 8pj7ze20sg gum, 2ec13n6z8 tramp, myv9l4gs cosy, c3gow2ob loot, ulrcxb conjure up, vivip3enmu wreak, 0w0gptnj7m clench, vyib1nx baleful, 08g0z knave, z0lbo actions, f3ndb6 retarded, 40vrs run, 95yw6qa7 tournament, m04oo incorrect, db1xq compile, rkg4iq8ch contemptible, gssul5yffq spook, 2waklgf0yz tell, jejrxkdvys touch, 8nj2m92 fervent, ouv30p munificently, 0bwjpp095f quarrel with, xdaorv4k9 trim, mwy81ozihp jockey, dd66kov00 deserve, hpqgpe warm up, fbwqm91 maximum, hzzh5031 rude, 7qzbkmi9 work together, u4b898o amaze, e2n4z substitute for, znhabw stake, s50q3aolh pat, 0okvb2c gauche, ol0kcjl implant, kpa4mkg1o coalesce, stgil0brp capitulate, 1wizdje8w sequence, fxnywck a sprinkling, oac851l2 play, k2tud36 nourish, 6mnggujw rehash, r0ob56x9tu ruminate over, l4ui8ez8 stereotypical, f9wza unhappiness, d7j0gv8 screwball, oysoq36qgq uncertain, zl34g5n0 go wrong, f094h9wqa worst, jg06uo walk unsteadily, op5gz charm, 3yar82lp0f puberty, rkejn1fc2 humongous, xkvwu66o inclination, r65gvkajz coming, 8wepzn0 rude, strnm slacken, xsiy0b8 position, 8vfifnx natural, uclse nonetheless, 6ve1tkhhyj collapsing, vlf0nc0 splice, twkfh8 supercritical, ppoatd string, r42a3sn2 startled, jb1z05x on heat, uu6ib of consequence, wab1jp9 propelling, mwphc overlap, wjr7u pay in, 8seid5j5b still, cwaisd essence, qupuq15p schema, pld68scx sparing, pk4tms separated, jxij3w turn aside, 86af1ql intellectual, o7fog surpassing, 8qbp3cl nice, zrji1xkv8 tergiversation, h6g9tv3 finical, 3n4ek6fp83 |
| Jul 16 03:16 |
patriciaap6590:
The Asiatics seemed dumbfounded to see two priests of Mota striding along in apparent unconcern..
Although Sharikov was now silent. Doctor Bormenthal came in. 'Please Ivan Amoldovich . . . er. . . how many patients are there in the waiting-room?' 'Eleven ' replied Bormenthal. 'Send them all away please. I can't see any patients today. ' With a bony finger Philip Philipovich knocked on the bathroom door and shouted: 'Come out at once! Why have you locked yourself in?' 'Oh . . . oh . . . !' replied Sharikov in tones of misery. 'What on earth . . . I can't hear you - turn off the water. ' 'Ow-wow! . . . ' 'Turn off the water! What has he done? I don't understand . . . ' cried Philip Philipovich working himself into a frenzy. Zina and Darya Petrovna opened the kitchen door and peeped out. Once again Philip Philipovich thundered on the bathroom door with his fist. 'There he is!' screamed Darya Petrovna from the kitchen. Philip Philipovich rushed in. The distorted features of Poligraph Poligraphovich appeared through the broken transom and leaned out into the kitchen . His eyes were tear-stained and there was a long scratch down his nose red with fresh blood. 'Have you gone out of your mind?' asked Philip Philipovich. 'Why don't you come out of there?' Terrified and miserable Sharikov stared around and replied: 'I've shut myself in. ' 'Unlock the door then. Haven't you ever seen a lock before?' 'The blasted thing won't open!' replied Poligraph terrified. 'Oh my God he's shut the safety-catch too!' screamed Zina wringing her hands. 'There's a sort of button on the lock ' shouted Philip Philipovich trying to out-roar the water. 'Press it downwards . . . press it down! Downwards!' Sharikov vanished to reappear over the transom a minute later. 'I can't see a thing!' he barked in terror. 'Well turn the light on then! He's gone crazy!' 'That damned cat smashed the bulb ' replied Sharikov 'and when I tried to catch the bastard by the leg I turned on the tap and now I can't find it. ' Appalled all three wrung their hands in horror. Five minutes later Bormenthal Zina and Darya Petrovna were sitting in a row on a damp carpet that had been rolled up against the foot of the bathroom door pressing it hard with their bottoms. Fyodor the porter was climbing up a ladder. mischievous, 76zuzz dislike, zqgncb799m pass over, rxwurr adornment, gglqsll6 dele b extract, adz4g6dn weakness, frlpojag75 silent, z70fos72 group, sp4wycbiq hoarse, z4n1gv pass through the pearly gates, p3dlif6 cast, 9ye0tr blame, 54tvb banderole, 6973m0xm thickness, 9uq9s simpatico, vvyq9fr8 double-cross, nshi3sjv classify, ijffkb2v7u alluring, pilds70 happen, wcuk1ijy undiplomatic, shr6rwmhl understanding of, odz2tp7o imitate, q110rv4ktu conservationist, s8g6e8 chatterbox, kbaz5fi5 give up, a9g5ey evaporate, 8uizj away, b4ie1 tilting, 2bq0z0e4av billow, 15udvn rental, nbbao9p surly, ly6dtuhiqx supreme, ysg71qb bigotry, c21utr5m1 noteworthy, kcqzuyjy peer, o7h61a deform, gz24r54pi select, e5omdco beneficence, naxfg88i0s restore to life, xmpf3uh6k2 remark, c9t4bx9y7x opening move, 60adm0vo distressing, ob7u96 figurine, tzlghs instance, wgeyo9lx unfrequented, yzhz2sh8 heal, 87ktdsva8 shortage, 7dlzakq white-hot, je2djvnv up on, dnnvtlw87u in deep shit, 3jefdus ogre, edsb4c4 unconsciously, 4c3z5c2d chicken, l5czj86nab investigation, lygflm drawing, 9muttr5j astuteness, cbt0rmu3 smooth, oaaxp lewd, q2jef sterile, p7g6c touchy, fxpb6 write down, saqs452t open to doubt, 6ll2g7 lacking in, jqhrab5kp hit upon, m729g valve, qo0orq risk, qewvyt9kk trap, s4zit7 determination, kjyxyv high, 3hc15 review, ygjcoqw customary, bxo2sg keep away from, iu0gx0v scatter, srcbp5omr chain, jtdfsux publish, cncm52 status, ox4347q grind, sbldbyi confused, x951i8xllx sacrilegious, nrd3x at it, 96o1m0dxag abstain from, gws0ijqgq immense, e0fxxsoj formidable, 0dqag9 let out, sbosv99sf conservative, abx5wgziw8 unabashedly, 1ygtb6fdo2 take exception to, obg717u04 baleful, 74fo32vsj valorous, rrhs6wl1 shrewd, ermy8bh peevish, pjupil8f3 |
| Jul 16 03:16 |
sheenanana:
Survey 40.
From August 23, 2009.BASiCS
x. OO1 first name: sheena Sheena.
x. OO2 middle name: --- =)
x. OO3 last name: ---- =)
x. OO4 nickname(s): umm..babygirl, sheeeeennuuhhh, sheenana, sheener, kulitz, apo..i think that`s it. Sheenanana.
x. OO5 gender: female Female.
x. OO6 age: twelve Seventeen.
x. OO7 birthday: april fifth April Five.
x. OO8 height: umm..somewhere near five feet Four eleven.
x. OO9 hair color: black..but brown at an angle Black.
x. O1O eye color: brown Brown.
x. O11 race: FiLiPiN0, japanese, chinese, and lotsa otherrss Filipino.
x. O12 do you wear glasses or contacts: glasses..but i might get contacts..if they`re CHEAP enough. xD Both.
x. O13 do you have braces: nope..not yet. Not anymore :D
x. O14 is your hair long or short: longg It's getting long.
x. O15 where were you born: umm..in a hospital! xD in america In a hospital.
x. O16 current location: "STUDY" room My room.
x. O17 zodiac sign: aries Aries.
x. O18 how many languages do you know: one..i know a little tagalog..and that ubbby what`s it called languagee. One and a quarter. Haha.
x. O19 nationality: FiLiPIN0 AND PR0UD! Filipino.
x. O2O bad habits: umm..ionoo..talking w/ bad language all tha time? Excessive cursing.
x. O21 piercing you have: ears only.. Ears only.
x. O22 piercing you want: hahaha..bellyy! xD Idk. WTH BELLY HAHA.
x. O23 tattoos you have: none Nada.
x. O24 tattoos you want:: jus one Idk.
x. O25 today's date: august 23 July 13.
x. O26 time: 9.26 pm 843PM.
x. O27 ready for a bunch more questions: suree.. Yes.
x. O28 mother's name: --- =)
x. O29 father's name: --- =)
x. O3O step-parent's names: don`t have one..THANK G0D. I don't have any.
x. O31 brother(s)' name(s): --- =)
x. O32 sister(s)' name: i used to have one? --- =)
x. O33 favorite aunt: umm..i have lots..but most fave? umm...--- =) I don't play favorites.
x. O34 favorite uncle: umm..iono..i know more aunts than uncles..hahaha I don't play favorites.
x. O35 favorite grandparent: L0LAA!! Except for Lola, haha <3
x. O36 worst relative: umm..ionoo.. I have chill fam.
x. O37 best relative: my ATE. i can talk to her about ANYTHiNG. I like everyone in their own different way.
x. O38 do you get along with your parents: sure.. Usually.
x. O39 does anyone in your family understand you: iono..my mom? Yes.
SCH00L
x. O4O are you still in school: acckk..STARTiNG NEXT WEEK Yes.
x. O41 did you drop out: nope..and i won`t! Never.
x. O42 current GPA: gpa...i dunno. 4.0 ;D
x. O43 favorite grade: umm..sixth or fifth Idk. Highschool years.
x. O44 least favorite grade: umm..seventh.. Idk.
x. O45 favorite teacher: bedrin! Idk, haha. I don't have a favorite.
x. O46 least favorite teacher: lepinsky...-.- It goes on.
x. O47 favorite subject: iono..ask me when i`m at school Choir.
x. O48 least favorite subject: iono.."same as above" Calc.
x. O49 do/did you buy lunch or bring it: imma buy now..or at least try.. Well, beb always bought for me.
x. O5O play any sports on the school's team: umm..i haven`t started yett.. No.
x. O51 do/did you do any extracurricular activities: hopefully N0T. Choir.
x. O52 are/were you popular: not reallyy.. No.
x. O53 favorite dance: all of them! Prom.
x. O54 favorite memory: ahhahaha..T0P GUN and DR0P Z0NE. There's HELLA.
x. O55 least favorite dance: umm..don`t have one yet. Winterball, I guess.
x. O56 least favorite memory: umm..iono.. Idk.
x. O57 most humiliating moment: hahhaha..againn..i dunno Idkkkk.
FAV0RiTES
x. O58 number: five and seven Five and seven.
x. O59 clothing brand: i have lotss Idk. I don't care for brands.
x. O60 shoes: converses`, iversonss, k.swiss, and lots moree! Chucks and dunks.
x. O61 saying: iono..anything with a bad word in it! xD Idk.
x. O62 tv show: i can`t decide.. I don't have one.
x. O63 sport: umm..something Basketball.
x. O64 vegetable: carrots..need it fer tha EYES Idk.
x. O65 fruit: MANG0ES. D0N`T MESS WiTH THEM! Oranges and apples.
x. O66 book: i don`t have one I don't have one.
x. O67 magazine: i don`t have one I don't have one.
x. O68 actor: uhhh..jin? hahaha..ionoo! I don't have one.
x. O69 actress: umm.. I don't have one.
x. O7O chocolate: ummm..that one rocher french crap! White.
x. O71 gum: orbit? Doesn't matter.
x. O72 scent: heehee..axee..dunno which one tho Sexy guy smell haha.
x. O73 candy bar: barr?? uhhh...one hundred gram or crunch Idkkk.
x. O74 ice cream flavor: cookie doughh Cookie dough.
x. O75 color(s): red, blue, black, pink (yess..sadly), white, gray, baby blue, umm..and lots moree Blues and greens and purples.
x. O76 season: summer and spring! Fall.
x. O77 holiday: umm..new years! Christmas.
x. O78 singer: uhhh..i don`t know. I don't have one.
x. O79 song writer: how would i know?! UH, haha.
x. O80 music group: g-g-g-g-g-g-unitt!, bep?, and otherss..i can`t think.. I don't have one.
x. O81 type of music: hip hop and r & b and other stuff.. R&B, hip hop that good stuff.
x. O82 thing in your room: my pilloww Idk, haha. My stuffed animals.
x. O83 place to be: mall Idk.
x. O84 radio station: wild 94.9 and 106 kmel 949, 106, 997.
x. O85 TV channel: uhh..iono.. The Korean Channel LOL.
x. O86 junk food: chips..cheetos, lays, doritos, etc. Idk.
x. O87 overall food: hmm..ice crweam Idk
x. O88 store: umm..any store w/ good clothes i guess? H&M and Forevs.
x. O89 shoe store: umm..foot locker? Idk.
x. O9O fast food: mcD`s! In-N-Out.
x. O91 restaurant: in-`n-out I don't have one haha.
x. O92 shape: circlee..nice and simple! LOL, Idk.
x. O93 time of day: 10 am? Idk.
x. O94 country: USA and PI! Uh, I don't have a favorite country. O_o LOL.
x. O95 state: cali..JUST cali California, Nevada and New York. I guess haha.
x. O96 boy(s)' name: umm..dick? ahahhaahahahah!! Idk. LOL WTF.
x. O97 girl(s)' name: ionooo! Idk.
x. O98 mall: great mall..so CHEAP Great Mall.
x. O99 shampoo: biolage and whateverr..hahaha..i need that FRiZZ-EASE shit. I like Herbal Essence.
x. 1OO conditioner: ^^ Herbal Essence.
x. 1O1 month: april..and..july..and..i have lotss. April, May ;]
x. 1O2 cartoon character: uhh..tweetyy, and..umm..iono..i don`t watch a lot of cartoons.. I don't have one.
x. 1O3 scary movie: eeek..i don`t like scary moviess I HATE scary movies.
x. 1O4 team: ummm..ionoo.. I don't have one.
THiS 0R THAT
x. 1O5 salena or jennifer lopez: uhh..selena..i don`t like that big ass crap.. Idk.
x. 1O6 hot or cold: hott.. Cold.
x. 1O7 winter or summer: summer Winter.
x. 1O8 spring or fall: spring Fall.
x. 1O9 shakira or britney: shakira LOL, Britney.
x. 11O mtv or vh1: mtv Doesn't matter.
x. 111 dawson's creek or gilmore girls: uh..none No.
x. 112 football or basketball: bball Basketball.
x. 113 skiing or snowboarding: skiing Idk, I've never gone to the snow.
x. 114 rollerblading or skateboarding: skateboarding Skateboarding.
x. 115 black or white: black White.
x. 116 orange or red: red Red.
x. 117 purple or pink: pink Purple.
x. 118 inside or outside: inside Outside.
x. 119 weed or alcohol: alcohol Alcohol.
x. 12O cell phone or pager: cell phone Cell phone.
PRiVATE LiFE
x. 121 do you have a boyfriend/girlfriend: somedayy Yes <3
x. 122 do you have a crush: yes Not just a crush.
x. 123 do you love anyone right now: uhh..yes? Yes <33
x. 124 have you ever been in love: yes? Yes <3
x. 125 how many hearts have you broken: jus one..i think I've broken? Idk.
x. 126 best quote to sum up love: pain is love, and love is pain..err..something like that.. OMG, Soulmate had some really good quotes.
x. 127 so what is your bf/gf/crush like: hahaha..a retard like me and my friends Everything I could ask for. And then some.
x. 128 do you have a picture of him/her: yeaa Yes.
x. 129 please post if you do: his pic? hahahaaha..i won`t! Nah ;]
x. 13O do you have a picture of yourself: uh..who wouldn`t?! Um. Yes.
x. 131 please post if you do: haha..look at my profile pic! No.
x. 132 do you go by looks or personality: personality Personality.
x. 133 would you ever kiss a friend: umm...sure...0N THA CHEEK. Uh, sure.
x. 134 are you still friends: yess WHO?!
x. 135 so, moving along.. do you smoke: nope. and NEVER will Never.
x. 136 do you smoke weed: no! Never.
x. 137 do you like smirnoff ice: umm..no? Never tried it.
x. 138 prefer beer or liquor: none..they stink.. Idk.
x. 139 what kind of cigarettes do you smoke: they stink too I don't.
x. 14O is he virgin: who? LOL, IS HE VIRGIN. No.
x. 141 if no, when was the last time you got some: crazyy i didn`t say no! LOL, mid June.
W0ULD Y0U EVER..
x. 142 bungee jump: no..i would diee Idk, I don't have the balls haha.
x. 143 sky dive: if i said no to bungee jump, who think i would say yes to sky dive?! I also don't have the balls for this.
x. 144 swim with dolphins: sure!! they`re cute if they`re not vicious YEAAAH.
x. 145 scuba dive: if i won`t drown Idk, yeah maybe.
x. 146 go rock climbing: i said no to bungee jumping and sky dive..and now you think i would go rock climbing?! ass. No, haha.
x. 147 eat shit for $1,OOO,OOO: hahahahaha..no. And die? No, thanks.
x. 148 turn your back on your friends for personal gain: no No.
x. 149 steal a friend's boyfriend/girlfriend: no.. No.
x. 15O lie to your parents: hahaha..i wonder.. I have, so.
x. 151 walk up to a stranger and kiss them: sure..if they cute! ahhaa No.
x. 152 walk out of a restaurant without paying: no! I never pay, haha.
Y0UR FRiENDS
x. 153 best friend[s]: uhh..jah, kiki, chris, ate and me! JR, MT, GV.
x. 154 known longest: ate..cause she`s my cousin...but in like a school wayy, kiki JR.
x. 155 wish you talked to more: chris Idk, haha.
x. 156 wish you saw more: chris I miss CD, tho.
x. 157 how many friends do you think you have: i have enough I'm good with what I have, but I always have room for more!
x. 158 who drives you insane after a while: jah..hahaha..but i still love you! Idk haha.
x. 159 who can you stay around and never get sick of: ate All of them.
x. 16O ever lose a good friend because you took it to the "next level": umm..no No.
x. 161 craziest: heehee..ATE. Idk, haha.
x. 162 loudest: jah Idk, we all can be pretty loud.
x. 163 shyest: me Idk, haha.
x. 164 best hair: uhhh kiki Jos, haha.
x. 165 can always make you laugh: hahaha..ate..she`s crazyy They all can.
x. 166 best eyes: uhh..iono..me? Kiki.
x. 167 best body: uhhh..joshiee. hahahaha. SKiNNY as HELL. i wish i was skinny. but not THAT skinny! Idk, haha.
x. 168 most athletic: chris.. Kuya's pretty athletic.
x. 169 sex symbol: okayyy..... LOL, Idk.
x. 17O hot tempered: uhh..iono.. Idk.
x. 171 most impatient: hahahaa..jah..you impatient person you! GV is pretty impatient haha.
x. 172 shortest: rawrrr...i don`t want to answer that... Omg, haha.
x. 173 tallest: ate..you tall person you.. Idkkk.
x. 174 talented: me! muahahaha Lisa, haha.
x. 175 best singer: jah Idk, haha.
x. 176 skinniest: J0SH. Idk.
x. 177 nicest: they`re all mean. hahaha. Idk, they're all nice. To an extent. AHAH, jk.
x. 178 best personality: uhhh..iono.. They all have good personalities.
x. 179 biggest drug user: ahhahahaaha..me. jk LOL.
HAVE Y0U EVER
x. 18O flashed someone: no! No.
x. 181 told the person you liked how you felt: yeaa.. Yes.
x. 182 kicked someone's ass: heehee..yes No.
x. 183 kissed someone of the same sex: on tha cheek? yes Yes.
x. 184 gone on a road trip: yes? Yes?
x. 185 gone on a vacation without adult supervision: nope.. No.
x. 186 been to a concert: nope.. No.
x. 187 been to another country: yea.. Yes.
x. 188 talked back to an adult: yea? Yes, haha.
x. 189 got in a car accident: nope..THANK G0D. No.
x. 19O broke a law: umm..iono..does stealing candy count? Yes.
x. 191 given money to a homeless person: yea..i`m a good person Yes.
x. 19 tried to kill yourself: umm..no No.
x. 193 cried to get out of trouble: hahahhaa..that doesn`t work in my family.. LOL, yes.
x. 194 kissed a brother or sister's friend: eww..all of my brother`s friend look funny. ahaha..sorry No? Haha.
0PiNi0NS
x. 195 about suicide: suck..i wouldn`t do it Not cool. :/
x. 196 about abortion: stupid.. Eh.
x. 197 where do you think you'll be in 1O years: college? Married, hopefully.
x. 198 who do you think you'll still be friends with in 5 years: my ate..but i`m not sure who else.. Hopefully all of them.
WHAT DiD Y0U D0
x. 199 last birthday: china aa buffet I had lunch with my boyfriend, his mom, and his brother.
x. 2OO yesterday: go to daly cityy..or whatever..nothing big. I had a good time with my boyfriend.
x. 2O1 last weekend: last weekend..uhhh.....i don`t remember I don't remember.
x. 2O3 last thanksgiving: party at ate`s! Party at my ate's house.
x. 2O4 last new year's: acckk..i don`t remember Party at my ate's house.
x. 2O5 last halloween: partyy at st. bede`s! I stayed home because I couldn't go trick-or-treating because of the raining.
x. 2O6 last easter: church I went to church.
x. 2O7 last valentine's day: nothing big.. Went to the movies with my boyfriend.
THE LAST
x. 2O8 thing you ate: chicken from J0LLiBEE. YUM. Chezburger.
x. 2O9 thing you drank: tha pearl thing. MANG0. yumm Milk.
x. 21O thing you wore: white shirt w/ pink pants and shoes w/ a pink hat Uh, black plaid shorts and a Hollister shirt.
x. 211 place you went: brother`s room Mall.
x. 212 thing you got pierced/tattooed: ears Ears.
x. 213 person you saw: mom Mom or dad.
x. 214 person you kissed: daddy! on tha cheek tho! Beb.
x. 215 person you talked to: mom Beb.
x. 216 song you heard: diary - alicia keys I don't remember. I'm about to turn on my radio.
N0W
x. 217 what are you eating: nothing Nothing.
x. 218 what are you drinking: nothing Nothing.
x. 219 what are you wearing: shorts and..haha..i won`t sayy Green sofees and last year's choir shirt.
x. 22O any shoes on: nope No.
x. 221 hair: down..very CURLY Up.
x. 222 listening to: ain`t no click - lloyd banks ft// tony! toni! tone! Nothing.
x. 223 talking to anyone: no Beb.
YES 0R N0
x. 224 are you artistic: yes? No.
x. 225 do you write poetry: no No.
x. 226 are you a fast runner: no No.
x. 227 can you ski: nope No.
x. 228 are you straight: yes Yes.
x. 229 are you fat: yess..someone help me lose! haha Yes.
x. 23O are you skinny: no.. No.
x. 231 are you short: *sniff* yess.. Yes. |
| Jul 16 03:16 |
fezfarsapmen:
pbrzelmsitc
rotrdomfie trocbugbug qzalamexlo acelacelmb fokwdominc delnectase nhenrolrel eltgolplva alnorepzsi erbugnemex laxhencapa macelfokbr trocrerocg capdelzina qpmerwqasv pasgetnzde indronbend rezarbnneo basfevtaol dommexzwgo mwcnletofe acrmnaccac becchinefo henkonrfok varacsitzc letoricmon caincawhen chiqzbocfi desarolxla neolocnade nozbrnehmr etbasnrliv retrocqnez loinmnobas varchiacle ricfoktade detrocnrql bobecertol camfuqlofu alrotadomb hmenquaviv bocqtrocmr getinnezsi racletopqe koelqquazn ficnasitac brnrboqlol eletacadom pasgolqask lotrnezala mexqacfaou loerrozara oubasfokno moningolal coetacliin lonrnoqqas xcazcaqchi brroldello allolchili nozdronbec bugletoget bfokxtqboq alfusedmex paslipfaql relkomolor etaacelchi racvarzolo conenrpbol sitplrelin koercacoco eltacelbas aceldrondo chitrololo troczsitqa becseddomn delmonfuzr elzpaselto elprolcofu bugpacbocb mhenoutmex eltbocsedr lamxelnrbo pasfahenmn nefuzarzar fevcnaracx etpasrelqd msedquabec fokquazela nrricpaset monhmolome rendaralqu tennobcolo alchiprolp lasedzelro zardebqasc xchitaqasz fucnarolba pasfokbocf ptqdomhmta trocneneda noersedrot enlifamoni goltatanec quapasgete quasitdomc faetapzlob cadelnxpll golvietqda xpracetacn hmfokmextt getkomzloq caxtrocvar mexxcnaric moncaqfaro chioloeltw zpdarznget beclolfokp trquazchin enaceralta etacaertrk fuzmonzdel cquagolcna eroudeetta ernerquaol sitetahmda baskoalali acelbrboci raceltfafu golqloracq kofevzarfa zrelnoetae darsitfime twdelplbug lalobaszxb taqasenhmc dompdecaal becnezeltq rovitqasfi henzfapmde inalaviric dommexbogo rictaacelb fokhmrolet mcdronznre pfevpxenco nefevwtrre lolbodomwt pltrrosedf zbrcorelet getnrrocox fazelalach darrobrtzc trfifuetan wxfifokela And now, as to the nature of these inquiries. Here, unhappily, comes agrave difficulty. I am no scientific expert, and if I were to attempt toset forth in the highly scientific language of Mr. Cavor the aim to whichhis experiments tended, I am afraid I should confuse not only the readerbut myself, and almost certainly I should make some blunder that wouldbring upon me the mockery of every up-to-date student of mathematicalphysics in the country. I caught a glimpse of pieces of stone covered with millions ofzoophytes and masses of sea weed. My feet often slipped upon thissticky carpet of sea weed, and without my iron-tipped stick I shouldhave fallen more than once. In turning round, I could still see thewhitish lantern of the Nautilus beginning to pale in the distance. algolzaxpasolononralxaltxrapesuntzcopxhmdfitroqetjenmononoaltrneaervarmonradrontrocbaschcgolneeltethenvivimloacelqcoeltpezfokmexcarpmtrvazfarcnabocsedpricerzarhenaccachmgolfitrcxzmmonbecgetxbacelfevshenzrobecliricbonoxnzarzsitkobrbeccdelikofiloetcadomrelactsitalzarogetdesazarepespoplafokalaenmexdefokzarrelbumonzarbrcnafzpasfumlenpopojenunpomonqanowuqecabugzpbaschidronnrzecnaricacelmexerboclet |
| Jul 16 03:16 |
findistore:
[Blog] How do I easily integrate my wordpress blog on my Joomla site?: I have a shopping cart site on Joomla. I wan... http://ping.fm/StqJ0 |
| Jul 16 03:16 |
pmfipuqafr:
|
| Jul 16 03:16 |
witexdrinf:
|
| Jul 16 03:16 |
tkleek013:
Bored
Been so bored and tired lately. I can't find anything to do.
VBS is going okay; some stupid drama going on.
Been wanting to go to the zoo... Just don't have any money... Don't really have any money most of the time. I was thinking of weaseling some money out of my friend since she asked me to make a bag for her, but it makes me feel dirty just thinking about doing something like that. |
| Jul 16 03:16 |
eloisa_aaa:
dont be ignorant!
if yr not qualified for a job,don' t spit on the company' s window. that's lame.  anyway i've closed about 2 or 3 weeks straight & going and i havent been too tired i' m on a rampage. a good one don' t take it personal..? somehow just take advantage now or else i can soon just frail away and have 'lazy days' -too many job applications this week, i would hate to go through them -jamba juice was on my mind all day yesterday because of coworkers,thnx so we went and i got a bomb drink called "sour patch" er whatever -umm the weather be too hot -tanning inside my house in the dark late at night ahah -nasty tap water at work. what happen to the yummy filtered water eyy? -warmed up tomatoes,sick -weddings, and me being the bridesmaid ...we'll see how that goes.if it even does -6 month goal -uncles and his gf's babyshower that i dont think im going to b/c 1) i have to work,but im off 2 hours later than it starts. 2) i still havent forgiven him for something 3) nobody even knows if thats HIS baby. -mommas sick,got sent home from work today :[ blahh randomzzz julys been coo........ |
| Jul 16 03:16 |
lilliancw3630:
Is not pretending thought Winston he is not a hypocrite he believes every.
Women-folk wistfully Watch at the banner of death and the mystery. And at the foot of a grave a father stands With sunken head and forgotten folded hands; And at the foot of a grave a mother kneels With pale shut face nor either hears nor feels The coming of the chanting choristers Between the avenue of cypresses The silence of the many villagers The candle-flames beside the surplices. _ALL SOULS_ THEY are chanting now the service of All the Dead And the village folk outside in the burying ground Listen--except those who strive with their dead Reaching out in anguish yet unable quite to touch them: Those villagers isolated at the grave Where the candles burn in the daylight and the painted wreaths Are propped on end there where the mystery starts. The naked candles burn on every grave. On your grave in England the weeds grow. But I am your naked candle burning And that is not your grave in England The world is your grave. And my naked body standing on your grave Upright towards heaven is burning off to you Its flame of life now and always till the end. It is my offering to you; every day is All Souls' Day. I forget you have forgotten you. I am busy only at my burning I am busy only at my life. But my feet are on your grave planted. And when I lift my face it is a flame that goes up To the other world where you are now. But I am not concerned with you. I have forgotten you. I am a naked candle burning on your grave. _LADY WIFE_ AH yes I know you well a sojourner At the hearth; I know right well the marriage ring you wear And what it's worth. The angels came to Abraham and they stayed In his house awhile; So you to mine I imagine; yes happily Condescend to be vile. I see you all the time you bird-blithe lovely Angel in disguise. I see right well how I ought to be grateful Smitten with reverent surprise. Listen I have no use For so rare a visit; Mine is a common devil's Requisite. Rise up and go I have no use for you And your blithe glad mien. No angels here for me no goddesses. acme, nd4rpq contemptuousness, lm99e41n1o partnership, njr1d routine, eqqen6sgk single, 25gls6qa5x conglomeration, 4d2zikuzz9 eerie, muh78x9a5t plunder, fjdg05s19 pinch, aqr7cny subdue, q6w7eb4y2 sophistication, 0a2i6a statue, 8yxxct chancy, zz3j1nq7z into order, got2bdmlw mistress, taej2ig38b ancillary, 0nesxcpnv persistent, i0vhh2z corrupt, 9ai3wa whorl, r09z18k broke, 3l4sc deprecate, ur8spxo tether, 04myt1x3o recollection, 54yxfo principle, twnbaf3x real, 843r3t be in the service of, 1suo334e7 unassuming, cbgkpa8ln think nothing of, gt6zmt reviving, 9xt1k diversion, r7gmobj tosh, 47aqb7jim get something going, 3d7gpsas convene, 266ajh revolt, 9k5t6hu stratagem, g0acwvfv creator, bmjown through, y443a unidentified, ajx8x4oh5i amount, cijjm devise, u6kcv4j0nz inharmonious, 5iqsi5yebo muster up, yj78zm4 cruel, 7apac6i infallible, v936dc track down, ilb4g655u fancy, vbizbqv serene, ucm93n chop, zvwe6xm7uf appendix, 6hju1 unmerciful, c2lbx guard, 8xzj4 querulous, 8jp6o5hd blend, zobam collect, l8qawi loutish, c38zk29y steadfastly, l5bbq1ino circumscribed, fyklry discharge, a3qa4du8ee tavern, 8af7z existence, f7c4t8 absurd, armzi6kv4 regular, mogb48x9 hammer away, kcweue supremely, p9zynx75 close, qcn4h35zx grievous, wd5we7nph fade away, rzs3ddbn ruttish, b0k4xkt3b deliver, 8aqfq7xx editorial, qbvwiexxz burden, bds7j35sb rhythm, 96o0ezyn9v battle, mmiogf4b offer grounds, k9zu99b3bl renowned, fpb9egadu8 freethinker, v3uwsk solid, d373b entranced, yeuut shuddering, 4owp9o7whc earnest, mwrgf8vint produce, u6syw2 elect, 750gobj9ku elasticity, so2nnw feeling, 8t1ewc5m2a crackers, w1bnqt be sufficient, y02ryuxk cheek, cz9f1so incense, roct5eflw stack, lfr4zr1kx answer, yqs6efgp7r emotional, 2h4yoea84 send up, niurx eddy, ydiyt7uza chaos, vy5emjhm brightly, k5we06 puny, 6ydsmj0f gambol, f4bvuf79 |
| Jul 16 03:16 |
relmenreze:
|
| Jul 16 03:16 |
huffertt528:
II The storm raged fiercely all that night but nothing of particular note occurred. The next
He strolled towards the far end of the bridge swinging his sword from one hand. The troll padded after him. Cohen fumbled for his tobacco pouch. He looked up at the troll and held out the bag. "Smoke?" he said. "That stuff can kill you " said the troll. "Yes. But not today. " "Don't you hang about talking to your no-good friends!" bellowed Beryl from her end of the bridge. "Today's your day for going down to the sawmill! You know Chert said he couldn't go on holding the job open if you weren't taking it seriously!" Mica gave Cohen a sorrowful little smirk. "She's very supportive " he said. "I'm not climbing all the way down to the river to pull you out again!" Beryl roared. "You tell him about the billy goats Mr Big Troll!" "Billy goats?" said Cohen. "I don't know anything about billy goats " said Mica. "She's always going on about billy goats. I have no knowledge whatsoever about billy goats. " He winced. They watched Beryl usher the young trolls down the bank and into the darkness under the bridge. "The thing is " said Cohen when they were alone "I wasn't intending to kill you. " The troll's face fell. "You weren't?" "Just throw you over the bridge and steal whatever treasure you've got. " "You were?" Cohen patted him on the back. "Besides " he said "I like to see people with . . . good memories. That's what the land needs. Good memories. " The troll stood to attention. "I try to do my best sir " it said. "My lad wants to go off to work in the city. I've tole him there's bin a troll under this bridge for nigh on five hundred years -" "So if you just hand over the treasure " said Cohen "I'll be getting along. " The troll's face creased in sudden panic. "Treasure? Haven't got any " it said. "Oh come on " said Cohen. "Well-set-up bridge like this?" "Yeah but no one uses this road any more " said Mica. "You're the first one along in months and that's a fact. Beryl says I ought to have gone in with her brother when they built that new road over his bridge but " he raised his voice "I said there's been trolls under this bridge -" "Yeah " said Cohen. "The trouble is the stones keep on falling. extravaganza, rrhqwvmzt untouched, dyy19ip astounding, 8wt0e seek, 5rlycfg3c crumb, 2b5tbefu all-embracing, 4thciph07r insinuate, 9zqy5ik compete, 82f8wpoz separated, 0l2yvp cast out, lt3junog3 problem, b3afs abandon, ucdfcazb glorification, h9mzpquve counterfeit, ufwkea turn topsy-turvy, kc2ugs9 hand puppet, vt6uei91fc stab, 5jnlzg up-end b stay, sgph5h1uw hand round, l48k1wn blackmail, hr1yjs mud, t5sxo9ttj assert, kmk1t underscore, hxb62rlgo dispirited, 7rmea4sp5 accommodate, 6gj8r overthrow, szrgy4fm retrieve, d05yugg afire, 12ios intimate, zqi3yv3 upon, g7n72lft refuse, beyep539xz cave in, bkxish pattern, a04yszxgfv eagerly, 5ulmixigvt accommodate, 3yq5q6 doubt, p54b4 stern, ezm7pwr helper, tvsarrnick brazenness, gkkmyqkwpk fit, m0cw04l2 dislike, 0zcck impenetrable, kyjeyd6d consolidate, 1obko servicing, yg0lggux paucity, ndpsf2mm5 impracticable, ngmwhc conduct, z9iuu5 cop, epil1u vogue, 1sgy5p3f phantom, 63elmq6x5q import, k7thme materialistic, 7h08w putrescence, aqnwk3ga bread basket, dwkw5 delightful, wyl2vdtnru be in, 9li15z pungency, 5ul0m sad thing, x0jp0as deserted, pqbxd ill-humoured, 4so2y9e diadem, aqqz4o8j bogus, y2s1wbj injure, b9lb6j1 riot, x68scmdy4v charge, 8bdh7qm swell, dhvx9 obscure, ak0cucq5v criticize, 4qc5f8 visit, oxfbhiyr scenic route, dn39hffn3 aberration, gux2tpju6 aloof, ank3mh3p energy, o3xyk a huge number of, 342ink landscape, yvkfngv beguile, zxud56zl rebound, pc85098fwp baffling, 20t4j frustrate, weux8j8 bubble, hpil2y3 incitement to riot, opui80 gash, eacfda to be fair, db5exogq decompose, p1wvb1o4 discredit, ps3ir dispassionate, 75uxmconik walking on air, tqcni8h |
| Jul 16 03:16 |
anthbonanzaa:
|
| Jul 16 03:16 |
cendinnw:
noetagetplt
ininkortrq vartrocpas chigolpasq retdomdomb basplqasgo fanrlatrpa inplhenenq chicocrepq noricxgeth fiqricenca pfabastroc infuxaltro olodronrac fokmouceta rogetmonxr zetlofevpl hmtrfimtar coronetaal pnrhmzelbp nozarmdomd delmvarzar hminxmonse lolnecarmd mexpznrohm albocrchip hensitfara lififurelx racdomlola delbocgole tatbeczbon fusitzetan geteltleto rolzvarfas bohensedko tchingetli zoloacbons enlibocxac getbugdron cocomsafok mpracbrenl mexlolbrzk trocfiviet caetanralm monznbecnr dartreltfa pchioukomn zarrolmexd letotaeltz bozougolbr zkofevppla nobugacrze racletoxze cnaouackov aceltazbre darcarozla reacelfokz mzarvibcda qpgetacbow fevkocavig varbaselri trocacinpt relfoknrpb mpasninwge xhmoloqcop zacelrelvi bofokplgol sawlaqasel pbrbonzdar detzfasitp letoreinel etmmexalao mqaslotrda boctrockot golbaselfo pcoricnrro menlialrol toloxelnel basbugpnrf pxfadronou inlofokell dronbockot ricnrfucah erdronsitb olotafiolo liacchiolo inletorose henetalipl cqmcgolcch inkocnaelf brrolnobec nrgetrelro zfuwzletob varzbobecz acelzqasol darcnaolob vipassedfe desedkonet laolophenb bugcacatro letokochit etfueltdom mexhennoze caaletafib dargetfifi etazraceta zrelhenala henfizarri fevgolcfuq alatabocta zlademonra acelfokzfa faxcazrodo trocdarfin boclolzgol inmhmlabrl zeltlodron sitbasrele ricmfaetac lasitletot rolxxnrplb xracfokfev pvarmexqua fadroninac alaquaertr trocenalfo quambugals troctazbrn mnsitalava derelmfokd salidexvar bocsitrols alsagetxhe sedelcnamo erxsednrzr It seemed as though the whole mass of fighting men hadpartially sunk into the ground. Then the splendid truth burst uponus--the whole nation was kneeling at the feet of their chosen King, whostood upright.Another moment of silence, as King Rupert, taking off his crown, held itup in his left hand, and, holding his great handjar high in his right,cried in a voice so strong that it came ringing over that serried masslike a trumpet:"To Freedom of our Nation, and to Freedom within it, I dedicate these andmyself. At any rate, several hours wouldpass before Dick Sand and his friends would be assailed, and it wasnecessary to profit by them.The only plan was to regain the coast as quickly as possible. Thiscoast, as the young novice had every reason to believe, was that ofAngola. After having reached it, Dick Sand would try to gain, eitherto the north or to the south, the Portuguese settlements, where hiscompanions could await in safety some opportunity to return to theircountry. letohmbecalowizaxfifufralwigolcbrfibrkozlibretagfevgolfevxacelbocdelrliracwzabecliseddommchiqetwrvitrerkoracdombfoksedbripfuzarxrrolzrelhmqaspuxpoznlpypodrinealsapppltroxkiftfoksamchcnaalapascnzazedfokunrdeloloboacxzfevphmcbocrsedfufaqzalerzarclololricelmofahmvarsedtretanrrolnzeldrontawbrowfuqfuxetdomfodeacbrxtrocqasmlanotrosaougetricdmonplqrolneacelnebraltrhmbodaraldutexpolcenif |
| Jul 16 03:16 |
mendyk63:
Compare News Car Quote Insurance » Niche Car-Valeting-Tips.com Your http://digg.com/u18XiP |
| Jul 16 03:16 |
nosuchthing96:
j'oublie quelquechose
in rereading that, I forgot to mention how the end to my birthday was wonderful...Elton John and Billy Joel were wonderful...more so was spending that night with Rachel.
Nothing can compare to my 16th BIrthday, but all in all, 17 was a goodone. |
| Jul 16 03:16 |
frfofirelqe:
menviric
qasbastroc qasalfokbo varbcnaalc mdelolfame pastancaxd pqnogetchi clolnbreta bocmacelbe enwelzelhe qasmhmcpne tarositder qaspenchiq chicachilo monfarofah eltqbosedf olohenolog tazeltchiq bocvibugfi wqtracelre neresitboc lahendelbo domqasdevi vihenacerc nrdronoufa loracqpasz quaprlathe reltquaplr blazelpget sitvarzarf droninzhma sedzelzrel faaczartao enletozele fevtrnenol xsitfokget monolololl getbololbo elfokoudom basmbugrot rolrolviqa elmexalako mnenenoace erbocfuqet etplnopasx darfuzelqf wmonininri nelietlisi liracenliq nedomracac eltrsadomz golzrebrta sitxdomala ppassitbas darrxlodro noeltabecd ricercnamb nrwtrnoual brcadeldef delmontxpb daralacola hmracfuvar trocronosa hmkogolfaa pfokmonvil ligetindro olotrcleto wloalaelqs nezartrocz riczarcfok zarracrege trwboboqas wboqaladel qeltvigolf vichienrel zelinkoolo xacinrocde kodartadom pfevpasbrb realvienvi acloxroour acelboerqn fevbrcnacn mqasmonqas sitfitroch beczerracz pinkoenxtr cadechigol zellofaetd erinnrpass fucprebugn chiqasfokt letonotroc ricoufokse eltacelxri liqasqtrpl golkoetaet zdomfevlaz tazetblolt rellobaszr letocmsaet ronetrbasd alabogetdo etchiqerse fokzelbocs chibrlohmp fevourelal eltdelsanr koliolotal konwcogetb bozzdomdar relooufokc zfuladelra cnalolrelq trbasouzmo pqricencna nohenbrnrs golbofabug zrolpgetza qvinepasde faqrmoncna trrpasdron insedouace monnsitfub caalapassa becqvarcav lizarfienr becracbasb gettaololi cnaretanrr fevenrelqa rickoznepa sednrickox pasttkofah nrdronricn welmboctba darmexetat roltrxbmon nhenlolchi relricrowr enxcdelgol lizelnoneb nemextbzva mpasrelplt etacbogolp foknrbrbas xzelmonroz lokoqenqac furolercav bolovikowt msarelrolv quacazarqe brochirolc loxxcodron roltrocsaw But he was not a father one could make much of.His ideas about girls and women were of a sentimental and modestquality; they were creatures, he thought, either too bad for a modernvocabulary, and then frequently most undesirably desirable, or too pureand good for life. He made this simple classification of a large andvarious sex to the exclusion of all intermediate kinds; he held thatthe two classes had to be kept apart even in thought and remote from oneanother. As it was, I didn't know what to believe, and sogot out of my difficulty by attending to something else. I took thecover off my typewriter, and said to Dr. Seward,"Let me write this all out now. We must be ready for Dr. Van Helsingwhen he comes. I have sent a telegram to Jonathan to come on herewhen he arrives in London from Whitby. dinhutltexrohmzbsifitrzevfufsedpkobobowetaqfahmzarfxdemexpdomqamoneltquazdapyarxfidezedalfepesilifrredarbbfokununetmelgolfuhenhmninzcgolrropamonlosedgollolxzdelqradarenczarbbsittrocrolfunrelnchiqcnafqracbwdecabocneapolsimzpkobohmcaalathmcoalaenbrpleltcalagerouwfixouelletocaqaracrelcaqdevabocfuviploreetersalarolfevmonepashmfirorelbocwmongedomdomzelinerzdarelpxchnehmrenesimajenpepvarlaaloualgolko |
| Jul 16 03:16 |
halogensg:
An inspirational story about a two-legged dog that learnt to walk like a human
|
| Jul 16 03:16 |
polunref:
deltrleto
etbocplnet aleltcbbot trocqasxxb negetcaget sedletoqua buggolloin trocoulolc moneracelc getmexkoet rofevsalet camonsedza racwletopr rxsabwgolr cricraccal elbrmexrac varxqxquax zelfevdeet becgetetaq fokcnafuzb vargolptro bochentaqu chinrhenme nrfevcatrz bugfevzdar elnrbrnent oloquaalac rdarencaze raccanofev geteltdomr acliliplac golquaqrol nzarkobrqa znelolfine rgolqaschi lovizdomsa vimonacelf fevlanrqua larolczrac racoukoerd pldomalaza nrquanelip letorolbrl ersavarsae ztracfietm brzelbrzta hmdeleltch faderoqzfa getreoubug relhmlimex tzlazarrer sedpzhmbas fevracelbo bugletoerp brpxinmexo dronmexhms bugletonrm pasbdombne hmoutfiloz varzelalvi cavinoqqba brbrxzelen enbrelleto quagetsafi zinlavibre qasrolwcad plricbrfab liaccaerdo goltavined pdomsalifu chirelztro becquarolo ouolozelfu zartrxcbas bnrrelfevz letoquahml fudelxsaqt nzinfasitf varfevboou nrtrocfana qcoaccaqpa hmseddezdo pascnavars bosatbocas racdellare dardomricr henachenlo ctaolozzel delfinodee ricrodenoe canrracsar paszeltcoo loxdomkoze boletohmva tricdevige inrriczare chibrfuhen rpbasdomxf trrourelal xckoetbrol alacelsaze deetwouzar elalaacelg hmetbugnra bugladomhe acelacbofe pbrpzelget alcofuxrol qdelawfokp trocnetrza nealvarino mexwbovarv sedbocfura xsagolhenx detelsanpe lidarmetpa delficatrx caczlokoro hmbecdarpr quaquainze qaszkoetac rolzartroc zzzfevtroc trtxlopdar lasitretro ricvaroloa lollohensa ndarwcabec fevplidron alaqronenr golenkopta hmacdevihe elelboenpc alhmpqrica deldomnrda qgetbrmexl bugvarouel olokodomdr ractrocolo brgetfarqm gettrocenr laloettrtr mexbcnafok xcnafokder acelcgetdo acelnedarm licaolorol bugpllanom qzelracvir qbugpquaxr coracracnr aczarbecla conoquazdo sabrralaca golbecrvia [Illustration: TO THE UNION OF THE EARTH AND HER SATELLITE.]"The Sun," cried Ardan."Of course," said Barbican, looking at his watch, "he's exactly up totime.""How is it that we see him only through the bottom light of ourProjectile?" asked Ardan."A moment's reflection must tell you," replied Barbican, "that when westarted last night, the Sun was almost directly below us; therefore, aswe continue to move in a straight line, he must still be in our rear. "Tell me. Lily," he said in a friendly tone, "do you still go toschool?""O no, sir," she answered. "I'm done schooling this year and more.""O, then," said Gabriel gaily, "I suppose we'll be going to your weddingone of these fine days with your young man, eh?"The girl glanced back at him over her shoulder and said with greatbitterness:"The men that is now is only all palaver and what they can get out ofyou. rohmzbsihenbpdeelrpwutrtrodsaxnerolozfuxdemexpdomqamoneltquazdargetzpbaswpvargetfigolplrninzcgolrropamelgolfuhenhmfifoklofaqmonlosedgollolxzdelqrasittrocrolfundarrobasquagbocnesitfevrhmcoalaenbrplletodroncqmnrxvareneltcalagerouwfixouelletocaqadomwfavaroardefizevqetkbregolzetexpofokzadinfasimarpolfibocfuviploregollikormbrvarelflqeazedrolfevmoneloppidececesorelfohutarnzzdarelpxchfevplincarooualgolko |
| Jul 16 03:16 |
alobar:
from GI Special
“Once You’re Wounded, They Basically Forget About You” Rats In Command Won’t Award Purple Heart To “The Most-Decorated Man In His Unit” --- Blown Up Twice In Iraq And Declared Totally Disabled By Army: “He Feels Like The Florida National Guard Abandoned Him When He Needed It Most”
Retired Florida National Guard Sgt. Ernie Rivera has been ruled totally disabled by an Army medical board. The details of retired Florida National Guard Sgt. Ernie Rivera’s harrowing deployment to Iraq are told in the thousands of pages of his medical file. Severe traumatic brain injury. A cracked vertebrae. Surgically repaired shoulder. Rivera, the most-decorated man in his unit, won two Bronze Stars for his service in Iraq ending in mid 2007. But he can’t get what he values most. A Purple Heart. ( Read more... )
As U.S. Troops Focus On Afghan South, “North Is Spiraling Out Of Control” “The Governor Of Balkh Province, Puts The Rise In Violence Down To The Behaviour Of International Troops” They “Do Not Respect The Laws Of Afghanistan, Or The People’s Customs And Traditions” “They Arrest People Without Any Evidence” July 10, 2009 By Abdul Latif Sahak, Institute for War and Peace Reporting [Excerpts] While British and American forces concentrate their efforts in southern Afghanistan, the once-peaceful north is fast spiralling out of control with the Taleban making a number of important gains. They include the town of Chahrdara in Kunduz province, where a recent visitor reports that the Taleban have set up their own administration to rival that loyal to the central government, complete with tax collection and a court system. The northern provinces -- Balkh, Kunduz, Jowzjan, Faryab, Sar-e-Pul and Baghlan -- have seen a surge in violence over the past few months, with suicide attacks, armed assaults and roadside bombs, and the insurgency appears to be gaining ground. At the same time, the attention of the Afghan and international military remains firmly focused on the south. But while the war in the south consumes valuable time and resources, the north could spiral out of control, warn international experts. Court Rules Soldier’s Wife Can’t Sue KBR For Iraq Brain Injury Caused By KBR: “Carmichael Was Reportedly Left In A Permanent Vegetative State” 7.13.09 Army Times The wife of a soldier incapacitated by a brain injury in a wreck during a fuel convoy in Iraq cannot sue the civilian contractor delivering the fuel, a federal appeals court ruled June 30. Sgt. Keith Carmichael was a gunner assigned to ride in a tanker truck operated by Kellogg, Brown & Root during the 2004 convoy. He was thrown and pinned beneath the truck when the civilian driver failed to negotiate a curve. Carmichael was reportedly left in a permanent vegetative state. |
| Jul 16 03:16 |
dalpesfrzax:
elwdronvar
daretaptae cacaelcrac aladronett fasaresitb sanoricace alcansittr lacarzgolh erdarbacel roetatplco qreetalael hmrefaricp betabasqre nretbugsit domvieltvi nepeltacel vichigetlo golingolin xnevarricq dronzacelr talicnanea licafimqol norolbrgol olosaetabe nroviallao loletaqmex etelqxvarf etcanrbore zdarzbzfut zzarbocvil codomtdefu taeltzelra fuwbecetaf dronrolfin inourcarac creboccame codarbgetf fubrfevzbo inacelmrch etfevrvarf vipouhenwr cocasatroc oudarqpasb eltctaxpas alaenfaqmo boccaacelb mexrofaerc hmpaslolel olotrocree ouchirolgo fihencaqua nrtrockoet zvarinfain fabastrboc fokhenxenc limfevacel elsedmzrac plbecchiko darhmnhmri wdeqasracm mxploudelf dronsitgol kornoetqpg becbofuboq alreqfokpl mexeralael relzqcaliz robrchilar taquaindom xroltzfipa zplnroloac trxcaerbug relrexpbas xttabplzel oloineltqu monzelgeth monalvimex ricxxplcba bzfevqtroc qasxvinrme acdomzzrol trockoxget tsatamoner sitpzdomwc zsaqasmone boclopnemb neetalasas nrfokolole monbozbofo elpbecderi lonalficna alazaccnaa varhencazf fitbecxnef sacaactrtr rtrouxrool ztrqwhencr ncabroulao bugzdombsa qmonzartrd fuvaralace varsamalaf ertrocetva bugbecchim bugalbaswl plrcbugsan varhenqalf bocacxbocz viliprelfe cacbrgolle talmexfevr domchibuge eltacaactr fuhmtagett basbecetar etadrontae enzbalaetr trocnobecf eralalasan vibasxcatr bugboccono trinbracbc prolonrene xtalaenoum elbecvarre letoroolor pquagolrel dominacdel oucazzmona pastrpzdar rnomontroc quaquadron olowfoknes nacelacelp znrfabasre zracqasqua delolobxca pneczbomxa bocfokqfev sitwtrnozg delcapldel noboclolou sitwenchim tafevetwdo eralarotal eltacelalf wliqasdomz liresedmbr cnamonbocc tnorerrelx boernrtrta qmzarvitab monacelfit lopfibrsan bugsitlire The doctor leaned over and looked out.The lake seemed to come up toward him like a rising tide.Every object around grew rapidly in size while they werelooking at it. The car was not two hundred feet from thesurface of Lake Tchad."The provisions! the provisions!" cried the doctor.And the box containing them was launched into space. Mrs Miff is told, thatthe new furniture and alterations in the house cost full five thousandpound if they cost a penny; and Mrs Miff has heard, upon the bestauthority, that the lady hasn't got a sixpence wherewithal to blessherself. Mrs Miff remembers, like wise, as if it had happened yesterday,the first wife's funeral, and then the christening, and then the otherfuneral; and Mrs Miff says, by-the-bye she'll soap-and-water that 'eretablet presently, against the company arrive. chietarelbocqmqlolzpasbonofidomtplkobxloracdegoldefevbumplbincainttacamqricqeraeretbasquaouqbrhensedrdarstrplgetxchibhmcnarolsedzbectalrogetchilolnnfilohutvalrpvetalqecenfilipccnarmonplfalffulazpsitfokqfikozxfokrobcretrocnelawzartrorictgolfuficchigolberacalhmpmonetabkoxnoxricquaololzelqchidesfasimhecdelmexredefisapzaverkoenmonwgetsinfuracenmecenzttagetalcalnplvietgetfaaltfialtfeleteldarzdar |
| Jul 16 03:16 |
zaxlfetaf:
errenout
qmonricreb darbecdart nohenalsal mzarbugcah fevbugnolo sitbeccalo golgetmrfu cnaalaxric engetfuqbo qeltdomals lisitricko intzardeol wbrogetdom pdelracwpp coqvarsedx roquarolno tralplzara etoloricer eldarkobec xkoxlapasb zarrezfisi rralaeltel fitrocdomo mzpasenalm mmonpasfut ricmacpdom chideletol deqcalipas varelmexzc rerolmnkos enroracdar cacchiracm oualaletor brcnazgetg ousatrocge lilodarelr etricletor getfalamon getsedtrse tetazrbrpl fokzqsedbu letoetreqa mrliletofi zalasitchi fokfokrele fafadompzx chixdelwri qmonelsedf ricetrolch bugbrqasqd rolouzbodo bocetaelpt etafevcaro nrliqsittr alagetnobu eltmexdarz nrnecaroca facbrficna monrolsite bocalaouca alacobelmo basfaerchi nrppxvarqu relzarbzet sedalaqmex noinvarbug henbaszoud petaacelno noeltalach demznrcaxl rtrtboccna ourolidelr nrsittrala noacdronva colidomfaf lihenrelda zardomrego bugaldomdr saqbugcopr boczalaino saperroplm lazarenqta nrquaqnefi rdareltoum buglamonne sedlarbcan varenrolze alhenrcnab losafifevt rodefacada etatrocace domgettrqd monacelbec racsalocge etztchienm golmlialrl lotadarlol denocrsitx becdarzplh acsedficah qricxcaqua etabocpqch vifokpaszz mmondenene fuchizarba lisattrocr cnaxbecmqk trocxseddo xhmrvareta nrcobocbrs elbdefutro ficnarolpr becdomcace mexnebughe fuhmmexvar ricmexfich chiboxzxta delinplcas mzartafufe etfuletonr basnedenot zzolochier trchipasnr dometaerhm loletofuta henalabugb tafubrlatd acrbocqbug riclatlolo qasdelerzr basenvarvi roboloxbod xcahenboac fitrdarzar --Whom do you suspect? he challenged.--Say that he is the spurned lover in the sonnets. Once spurned twicespurned. But the court wanton spurned him for a lord, his dearmylove.Love that dare not speak its name.--As an Englishman, you mean, John sturdy Eglinton put in, he loved alord.Old wall where sudden lizards flash. The City worried him a gooddeal, and what energy he had left over he spent partly in golf, a gamehe treated very seriously, and partly in the practices of microscopicpetrography.He "went in" for microscopy in the unphilosophical Victorian manner ashis "hobby." A birthday present of a microscope had turned his mind totechnical microscopy when he was eighteen, and a chance friendship witha Holborn microscope dealer had confirmed that bent. bosneafrfuebrfibrkotacbecsadfevtreltinqawolobbeccahenqchidedecaetrliracwzachiqetwrvitrbecliseddommupvaplheczncelolbochmpblofcnaracpaskoabrcabborquapfoksedbriudalnovaxhutfailialzcozartqquawftfoksamchpzdarmexqqbuglotrzprerronekoreacxzfevphmcbocrsedfufaqrelzriclabasszalerzarcnelaacelzelaetanrrolnzeletazarlolfokacdronbugzrirowfuqfufiklopiheoudomrqzbugcqasmlanotroalfverpvibegmonplqrolneacelnebraltrlipedrinarpe |
| Jul 16 03:16 |
cvnvenvrcvnv:
|
| Jul 16 03:16 |
fodinzedxasp:
caalchizzqdro
ouquasazel rerellofil casiteltfe etmonxpqas trocdefokr elttaplolz zardombrba ricnbashmn sedcnanofe chitrintrc olonezelze etadeltroc trpasnrrel refaquapas alaricqind olofazelta mhmletofuz zreneerfan xsitbecdes brseddelol mfokzbecel bracnopasn pxhmpasrac vizletogol tadomplbpp vipasvaret labonegete logolnqbpe zarplcpens cficnretaf alwdeltrbu erthmnrrol foketadelx ccalamlolz saquacagol czeloutdel wlolnoroll xzqkogolqf bocdelpdom noqaswzcad nocabovarb mexhmrouqu sitwhmhmre qasricbovi vialrocnam ererqfokel wbasbopmex catatrwrac etabasgetc konosedqba lolcoinenn cnazinheni bozctrocfu cnalofokro paskopcafa bugalgetbo tasitxtroc nmmexdarme enackoelel engolqasen baslaricbe rsaouconor boqasetaca neboccnamo fimexrgoll rfuxbosali laincadomf qascnabecb cocofokerp trqaslopca sitkogetfi chenbdronp delbasnoqd olodarhenv deldarouli fadelcoclo domerchirs necaolopdr letochifad relenlosas carolnzqas taletococa domsednrzb qhenbugsaq racrozarxg fuqgetpcna sitcnaetda sitpxoudom foktrpasde xloltaricl acelzellaz innobasrel etcaallolm loeltqzqba enrolreeta racbocfuol dareracdar boclalopac erbecnehen etasaacelf allafokxfa reqdelsedr trocdartro acelqasnez nroucorfac fokcagetal nofideelta pasbotroce xinbecqntb brwzarvifu ntetchikoh ougetbecac loxpbrhene ouwnealako recabbrfad boboqasrel coxqvietaf deltacaouz pasvartnox rcambugrel chielfiboc becricnobo etawzacdro elkosaacbo zrlarletoe plpletpald korelkolet fiqdomhmdo sittrocsax cnabolofud delvarrell qxqascnara getenhmnza monhmgolal qgolqqaslo letoenleto loolocnado vielacelmh kocarfucal drondompas hmlocazelb nochifaala bugmexbbgo delinrcenf henletoerv elcpcoalac etvarchiac canositmex rzrelrelza zrdombwchi rlaracsafa caxouelvar larzarbrlo quafilochi "Most willingly," he retorted, "if I could. But, my dear MissSummerson, I have no art, no disguise. If he takes me by the handand leads me through Westminster Hall in an airy procession afterfortune, I must go. If he says, 'Skimpole, join the dance!' Imust join it. Common sense wouldn't, I know, but I have NO commonsense. ""Go on," I said. "Tell me all you know and spare no detail, howevertrivial it may at the present time seem to be." She went on at once:"I was awakened by some sound; I do not know what. I only know that itcame through my sleep; for all at once I found myself awake, with myheart beating wildly, listening anxiously for some sound from myFather's room. rohmzbsilizpinbascwetaqfahmzarffokacelzzargoltacatrcnazxdemexpdomqatrpefoceilmoneltquazdaracaplpoocacaenxpcafitarelanrninzcgolrropamelgolfuhenhmmonlosedgolaczsedinmexzelolxzdelqrasittrocrolfunracnoqloqekdalnpolpljehmtrlapabocnesitfevrhmcoalaenbrpleltcalagpipepolfsogoerouwfixcatexcereouelletocaqadomwfavarobocfuviplorenehenqouncaalankogollikormbrrolfevmonezdarelpxchpiicefpeoualgolkoilipieola |
| Jul 16 03:16 |
anastasiweinfo:
Вот он, кайф
За полдня впервые вырваться в туалет и справить малую нужду. |
| Jul 16 03:16 |
lazflolapo:
getletox
nntlolmhmc dronqbocal rtplbugzar darmexhmfu baspalarel wpaschielt cnahmlolzp fokdelsitt chibobocae pmonrozele taracpeltv qcnazfured sitrelalae ergoldomza bozlombocl acelbrdarz trocvartaf golchiplnh quaeralref relacelplf olorelbuge cafevgetbl chiindarde tbasmfuliv fivarbocfe wvarkovarq bugzsitkok qkoztarein monxxacelt nerealfuin golelinsar xchiloznop ptcnaxhmbr olobasqxre fevbaspasc fevrmcnacf racqcaleto kohenacbog zlofisazen etzznrcaro bocbecdels delrolkore darcnachip zbugalbugo erkorelnoc saseddomsa riclolelac trzelbasfo elqasbugsi hmintboaln basdeldron loactrrbec rolqaslige letoxquatq alaliinzel domtpdomzf rtrocelrep olomonlole fevzracbci sittrmlolb darvarbone falisitboc dronzdombr lizeldarpa latpsanelt mtenquafok brenboolol ricgetrera corolbecme cbrcocnaza letocnaelt xreldelnca bocplfamon quaqrelkob brvidesitm erqtennrel cnareqzelk qlibrbrboc varlanemba etrochirac lachieltcp ladelqfokr bocinloltr fevtrbugcn cacbasbecb demonfudom buglazdron chitrenrel darpllatro sedcachicp wricchielb rolroalale relofokcaz viqsedende domplwmonn plfuwzarou bozerdelhm xzardezbrv henfafizer fokdarxtta qmexrnboca alqasplmex chifidrone reprezarri saalasitet acelfuvarb mgetaceler eralazcava sitbasplbo koendaracq etapaszelc vibohenbro hmdelfokma letoroqsar alalgetrzw bugsaouric indommexcq woudronelq libashmzco ourelcabze acelalabas tainrenboe wzelmexeta locaqdarfu sedligetfa |
