Home : Search : By Interest

Interests

Advertisement

Try searching posts and comments with the new LiveJournal text search

Find people and communities interested in:
 
Modify your interests based on those of:
 
 

Results for communities interested in "sleepy hollow"

344 matches:

  • [info]period_drama - Period Drama Graphics (Updated 3 hours ago)
  • [info]burtondepp - Burton/Depp (Updated 6 hours ago)
       Community for the fans of collaborations of Tim Burton and Johnny Depp.
  • [info]johhnydepp - Johnny Depp Fans (Updated 7 hours ago)
  • [info]movie_freaks - Addicted to Movies (Updated 7 hours ago)
  • [info]_timburtonxcore - Tim burton movie fans (Updated 7 hours ago)
  • [info]deppstills - Depp Stills - a Johnny Depp icontest (Updated 9 hours ago)
       A Johnny Depp icontest
  • [info]jdepp_lovers - For all Johnny Depp Lovers out there (Updated 11 hours ago)
       This community is abt anything related to Johnny Depp. Feel Free To Share Ur Graphics Here.
  • [info]fantasycostume - Fantasy Costume (Updated 16 hours ago)
  • [info]arsenicfashions - Arsenic Fashions (Updated 1 day ago)
  • [info]dark_artt - Dark Artt (Updated 1 day ago)
  • [info]spookystyle - The Spooky Style Guide (Updated 1 day ago)
  • [info]tim_burton_ru - Tim Burton по-русски (Updated 1 day ago)
  • [info]burton_beauties - Tim Burton stamping community (Updated 1 day ago)
  • [info]timburton - The first (and best!) Tim Burton Community (Updated 1 day ago)
       Tim Burton
  • [info]johnny_depp - Fans of Johnny Depp (Updated 1 day ago)
  • [info]prombound - Prometheus Bound (Updated 1 day ago)
       Brisbane's Premiere Steampunk Event
  • [info]sweeping_epics - Lovers of period films (Updated 2 days ago)
  • [info]horroricons - Horror Icons (Updated 2 days ago)
       Graphics related to horror movies, games, books, comics etc.
  • [info]vidding_archive - Lost Library of the Vidders (Updated 2 days ago)
  • [info]horror_movies - Horror Movies (Updated 3 days ago)
  • [info]__just_graphics - Just x Graphics (Updated 3 days ago)
  • [info]timburton_icons - Tim Burton Icons (Updated 3 days ago)
  • [info]johnny_icons - Shame About Raisins (Updated 4 days ago)
  • [info]deppicons - Deppicons (Updated 4 days ago)
  • [info]closetgoths - closet goths (Updated 5 days ago)
  • [info]depplove - johnny depp love (Updated 5 days ago)
  • [info]johnnydeppfans - For all those Johnny Depp fans out there... (Updated 5 days ago)
  • [info]johnnyd_icons - johnnyd_icons (Updated 5 days ago)
  • [info]hoivenicons - Hoiven! (Updated 6 days ago)
       Graphics made by lastwordslinger
  • [info]all_hallows - This is Halloween 2009! (Updated 1 week ago)
       A year-round celebration of Halloween.
  • [info]brizzo - God Child Diary - for cain and Kaori Yuki fans! (Updated 1 week ago)
  • [info]realitys_edge - Reality's Edge (Updated 1 week ago)
  • [info]mervin_graphics - Mervin's Graphics (Updated 1 week ago)
  • [info]johnny_daily - Johnny Depp Daily (Updated 1 week ago)
  • [info]costume_icons - Sweetness (Updated 1 week ago)
       Icon Comunity for Movie/Theatre Costume related icons!
  • [info]tikketyboo - graphics by naybob (Updated 1 week ago)
  • [info]victorianera - Lovers of Victoriana with a Futuristic Edge (Updated 1 week ago)
       I guess this was/is a proto-Steampunk group? Treat it as that, but join up, join up!
  • [info]love_square - Love Square (Updated 1 week ago)
  • [info]realmofsilence - Jadis_88's graphics (Updated 1 week ago)
  • [info]panniers - liaisons dangereuses (Updated 1 week ago)
  • [info]depp_fanart - Johnny Depp Fan Art (Updated 2 weeks ago)
  • [info]icon_spengler - Spengler Labs (Updated 2 weeks ago)
       Septentrio's meager icon journal of various fandoms and miscellany.
  • [info]burton_icons - Tim Burton Icons (Updated 2 weeks ago)
  • [info]dailydepp - Daily Depp (Updated 2 weeks ago)
       A daily news/picture community for actor Johnny Depp
  • [info]___timburton - Tim Burton Fans (Updated 2 weeks ago)
  • [info]storybookland - The Art of children's books, fairy tales, & fables (Updated 2 weeks ago)
       Art of Children's Stories
  • [info]horror_films - 6 6 6 (Updated 2 weeks ago)
  • [info]ricci_icons - riccicons {} (Updated 2 weeks ago)
  • [info]21plastichearts - \\ BESERK MODE \\ (Updated 2 weeks ago)
  • [info]sleepy_hollow - Sleepy Hollow (Updated 2 weeks ago)
  • [info]johnnydepprules - Johnny Depp and POTC Fans (Updated 2 weeks ago)
  • [info]depp_graphics - Johnny Depp graphics (Updated 2 weeks ago)
  • [info]depp_elite - DEPP ELITE; (Updated 2 weeks ago)
       the elite johnny depp icon community.
  • [info]xxxdeppxxx - Johnny Depp Lovers (Updated 2 weeks ago)
  • [info]deppophiliacs - Deppophiliacs: A community devoted to Johnny Depp. (Updated 2 weeks ago)
  • [info]halloweenasylum - Crazy About Halloween? (Updated 2 weeks ago)
       An awesome community about the bestest of holidays: Halloween!
  • [info]still_epics - EPICS: ICONED. (Updated 3 weeks ago)
       multi-fandom icontest
  • [info]caribbeandreams - Loving the pirates Jack Sparrow and Will Turner (Updated 3 weeks ago)
  • [info]mysticalicons - mysticalicons: too good to be true (Updated 3 weeks ago)
       ...graphix by iluvpoto...
  • [info]_thehorror - CLASSIC HORROR FILMS (Updated 3 weeks ago)
  • [info]jiiive - icon community ran by boredess (Updated 3 weeks ago)
       random icons that will interest you!
  • [info]belleslibrary - Belle's Library (Updated 3 weeks ago)
  • [info]miranda_fans - Miranda Richardson Fans (Updated 3 weeks ago)
  • [info]darklinksnews - Dark Side of the Net (Updated 4 weeks ago)
       Darklinks.com goth, Halloween, horror and industrial links
  • [info]movieobsessed - MovieManMenzel's MovieLand Mania (Updated 5 weeks ago)
  • [info]horrorfiends - Community for Fans of everything H O R R O R (Updated 5 weeks ago)
  • [info]solnacist - Snapshots- A Multifandom Reccing Journal (Updated 6 weeks ago)
       reccing, fandoms
  • [info]thdarkarts - The Dark Arts (Updated 6 weeks ago)
  • [info]nightshade_rate - Which Burton babe are you? (Updated 6 weeks ago)
  • [info]kitd_recs - Kittens in the Dark - Recs! (Updated 7 weeks ago)
  • [info]blackdossier - Black Dossier: Where words go (Updated 7 weeks ago)
       Character development by Alice
  • [info]factory_icons - Icons Factory (Updated 7 weeks ago)
       icons community
  • [info]jadcreations - Just a Dreamer Creations (Updated 7 weeks ago)
       A Web Archive of Creations by justadreameruk
  • [info]horror_vids - Horror fan videos (Updated 8 weeks ago)
  • [info]film_fan - The film review community. (Updated 8 weeks ago)
  • [info]itsuncanny - It's Uncanny! - A Tim Burton Community (Updated 9 weeks ago)
  • [info]articatx - Cartxu's Graphics (Updated 10 weeks ago)
  • [info]tim_tams - A Tim burton community...please join (Updated 10 weeks ago)
  • [info]johnnyrocks - Johnny Depp (Updated 10 weeks ago)
  • [info]johnnyfanfic - Johnny Depp Fanfic (Updated 10 weeks ago)
  • [info]silencexile - Silence Exile Cunning (Updated 11 weeks ago)
       Johnny Depp, a great Actor, Director and Humanitarian.
  • [info]depp_fans - Johnny Depp Fans (Updated 11 weeks ago)
  • [info]horror_writing - Horror Writing (Updated 11 weeks ago)
  • [info]johnnydeppfan - Johnny Depp Fan (Updated 11 weeks ago)
  • [info]cute_n_evil - cuteandevilclothing (Updated 11 weeks ago)
  • [info]johnnydose - A daily dose of delicious Johnny D. (Updated 12 weeks ago)
  • [info]johnnydeppluv - Johnny Depp Luv (Updated 12 weeks ago)
  • [info]johnnylovers - johnnylovers (Updated 12 weeks ago)
  • [info]johnnydeppfan1 - Johnny Depp Fans (Updated 12 weeks ago)
  • [info]saltyaria - saltyaria graphics (Updated 12 weeks ago)
  • [info]elfmanesque - Music For a Darkened Theater (Updated 13 weeks ago)
  • [info]leia06graphixs - My Artistic Domain (Updated 13 weeks ago)
  • [info]rosedark_icons - Rosedark Icons (Updated 14 weeks ago)
  • [info]faraway_land - Folklore & Fairy Tale Fans (Updated 15 weeks ago)
  • [info]johnnymovieicon - Johnny Depp Movie Icons (Updated 15 weeks ago)
  • [info]newbieguide - The Newbie's Guide to Fannish LiveJournal (Updated 16 weeks ago)
  • [info]all_japanese - For all who love japanese (Updated 17 weeks ago)
  • [info]hudsonhikers - Hikers of the Hudson River Valley (Updated 17 weeks ago)
  • [info]deppanonymous - Depp Anonymous, for all types of fans (Updated 18 weeks ago)
  • [info]home_scary_home - Home Scary Home (Updated 18 weeks ago)
       Scary Homes
  • [info]hexxt - ::HeXxt:: (Updated 19 weeks ago)
  • [info]girlfridayicons - girlfridayicons (Updated 19 weeks ago)
       costume drama icons
  • [info]amoriconz - Amoriconz (Updated 20 weeks ago)
  • [info]depp_stillness - Johnny Depp Stillness (Updated 21 weeks ago)
  • [info]jdepp_lims - Johnny Depp LIMS (Updated 21 weeks ago)
  • [info]bobs_shadow - триллеры и фильмы ужасов (рецензии и анонсы) (Updated 22 weeks ago)
  • [info]funeral_home - Everything Beautiful Dies (Updated 22 weeks ago)
  • [info]christopherlee_ - Christopher Lee fans (Updated 22 weeks ago)
  • [info]misfits_inc - misfits (Updated 23 weeks ago)
  • [info]imhotepbitches - NOT THESE GUYS AGAIN! (Updated 25 weeks ago)
  • [info]ricci_world - CHRISTINA RICCI WORLD. (Updated 27 weeks ago)
  • [info]jcd_ocd - JCD//OCD (Updated 28 weeks ago)
       For those of us who can't get enough of Johnny Depp!
  • [info]ichabod_depp - For fans of Johnny Depp's ICHABOD CRANE character (Updated 28 weeks ago)
  • [info]____gunxbang - _ _ _ _gunxbang (Updated 29 weeks ago)
  • [info]_lifelessness_ - Lifeless Fools (Updated 29 weeks ago)
  • [info]_welove90 - 1990 - 1999 (Updated 29 weeks ago)
  • [info]erikagiry_icons - Erika Giry Icons (Updated 29 weeks ago)
  • [info]tick_caps - Caps by tick_ (Updated 30 weeks ago)
  • [info]jdeppicons - Johnny Depp Icons (Updated 31 weeks ago)
  • [info]asiangoths - Asian Goths (Updated 34 weeks ago)
       Goth culture for the East
  • [info]halloween_town - THE ORIGINAL N.B.C. COMMUNITY. (Updated 34 weeks ago)
  • [info]scarlet_designs - scarlet designs (Updated 36 weeks ago)
  • [info]lovettdream - .::lovett dream::. (Updated 36 weeks ago)
       where all your dreams come true!
  • [info]jaynasicons - Simple and Clean Icons (Updated 37 weeks ago)
  • [info]barking_irons - For all things Barking Irons (Updated 37 weeks ago)
       Anything Barking Irons
  • [info]icons100by100 - The icons and graphics of Haldir_lives13 (Updated 38 weeks ago)
  • [info]thrill_icons - THRILL ICONS (Updated 42 weeks ago)
  • [info]mango_icons - mangofandango's icons (Updated 43 weeks ago)
  • [info]best_browneyes - Brown Eyes (Updated 44 weeks ago)
  • [info]tbcollective - Collective Boogaloo (Updated 45 weeks ago)
  • [info]_corpsebride_ - Your 1st Official Corpse Bride Community (Updated 45 weeks ago)
  • [info]_suicidekitten_ - Art of Karla Ruiz - SuicideKitten Icons (Updated 45 weeks ago)
  • [info]dannyelfmanfans - + THE DANNY ELFMAN COMMUNITY + (Updated 46 weeks ago)
  • [info]_magickalicons_ - *~*The Magick Shoppe*~* (Updated 47 weeks ago)
  • [info]starsfellondepp - Oh, Johnny! (Updated 47 weeks ago)
  • [info]tick_icon - Icons by tick_ (Updated 49 weeks ago)
  • [info]o_d_d - Obsessive-DiCaprio/Depp-Disorder (Updated 50 weeks ago)
  • [info]movie_nazis - Movie Nazis (Updated 50 weeks ago)
  • [info]bloomndepp - ♥ Bloom n Depp ♥ (Updated 52 weeks ago)
  • [info]westchester - westchester (Updated 53 weeks ago)
  • [info]the_bad_things - The abstract approach to sanity... (Updated 54 weeks ago)
  • [info]depp_domain - Depp_Domain (Updated 56 weeks ago)
  • [info]lovedepp - Фан-клуб Джонни Деппа (Updated 57 weeks ago)
  • [info]beneath_thesong - * A New color to paint the World * (Updated 58 weeks ago)
  • [info]souldrop - Souldrop Graphics (Updated 59 weeks ago)
  • [info]jdepp_filmclub - The Neverland Man: The Johnny Depp Film Club (Updated 60 weeks ago)
       Johnny Depp film worship and Johnny Depp worship
  • [info]geelongfc - Geelong Football Club (Updated 60 weeks ago)
  • [info]morbidwednesday - Morbid Wednesdays - A Christina Ricci Community (Updated 64 weeks ago)
  • [info]ffabcentral - Fanfiction Association of Britain (Updated 64 weeks ago)
  • [info]ha_free_store - Halloween Asylum's Free Store (Updated 64 weeks ago)
       Store of Free Printable Stuff for Halloween
  • [info]loserlyluv - Loserly kid (Updated 70 weeks ago)
  • [info]dannyfic - The Danny Elfman Fanfiction Community (Updated 73 weeks ago)
  • [info]lobagris_pelis - lobagris_pelis (Updated 74 weeks ago)
       movies
  • [info]costumedramavid - Costume Drama Music Videos (Updated 75 weeks ago)
  • [info]homology_cubed - Fanfiction Recs for All (Updated 76 weeks ago)
  • [info]graphics_narnia - Narnia Graphics (Updated 76 weeks ago)
  • [info]midnitesociety - The Midnite Society (Updated 77 weeks ago)
  • [info]maiconography - maiconography - etilia76's graphic journal (Updated 77 weeks ago)
  • [info]bluelake - Blue Lake Fine Arts Camp (Updated 78 weeks ago)
  • [info]do_me_victor - Corpse Bride #1 and First Fan Site! Honestly! (Updated 81 weeks ago)
  • [info]bewitched_me - A Sleepy Hollow- Ichabod/Katrina Shipper Comm (Updated 83 weeks ago)
  • [info]flackmistress - icons and graphics; by lerdumcyllus (Updated 86 weeks ago)
  • [info]scary_style - Horror Homes. (Updated 86 weeks ago)
       Halloween & Horror Decorated Homes.
  • [info]ricci_hardcore - Christina Ricci Crush Community (Updated 88 weeks ago)
  • [info]aoi_screenshots - aoi_screenshots (Updated 88 weeks ago)
  • [info]_wishbone - Wishbone (Updated 91 weeks ago)
  • [info]jd_phonebook - Phonebook (Updated 92 weeks ago)
       A movie that Johnny Depp should star in where he will read a phonebook, eat chinese and other things
  • [info]lonely_kids - Love Makin' Friends (Updated 92 weeks ago)
  • [info]souless_village - Area 51 (Updated 93 weeks ago)
  • [info]oingoboingofans - Oingo Boingo: Fans on LJ! (Updated 93 weeks ago)
  • [info]mystic_graphics - Mystic Graphics (Updated 94 weeks ago)
       Multi-Fandom Icons, Banners, Layouts, etc.
  • [info]neytaricons - The Icons of Neytari Took (Updated 94 weeks ago)
  • [info]nightmare_ru - The Nghtmare Before Christmas (Updated 95 weeks ago)
  • [info]deppfanfiction - Depp Fanfiction (Updated 96 weeks ago)
  • [info]_cillianmurphy_ - Everything Cillian Murphy Everyday (Updated 96 weeks ago)
  • [info]filmbooksmusic - Recommend your favorite movies, books and music (Updated 97 weeks ago)
  • [info]loserlykid - LoserlyLuv (Updated 97 weeks ago)
  • [info]gore_x_whores - Gore_x_Whores & Scream_x_Queens...Rate Us... (Updated 97 weeks ago)
  • [info]blauebananen - Blaue Bananen (Updated 99 weeks ago)
       Filmkritiken
  • [info]trappedhere - Trapped Here... (Updated 99 weeks ago)
  • [info]johnny_freaks - johnny_freaks (Updated 100 weeks ago)
  • [info]_depp - The Lovers of Johnny Depp (Updated 101 weeks ago)
  • [info]burton_stills - Icon Challenge for Tim Burton Films (Updated 103 weeks ago)
  • [info]fantasy_contest - Magical Icon Challenges (Updated 106 weeks ago)
  • [info]exorcist_fans - Captain Howdy Loves Reagan (Updated 108 weeks ago)
  • [info]ch_arts - Lost Highway [[Challenges]] (Updated 110 weeks ago)
  • [info]_horror_whores_ - A place for those who love all things horror. (Updated 113 weeks ago)
  • [info]cocklove - Cock <3 (Updated 114 weeks ago)
  • [info]christo4walken - christo4walken (Updated 115 weeks ago)
  • [info]johnnydepp_hush - Johnny Depp Hush (Updated 115 weeks ago)
  • [info]depp_vids - Johnny Depp videos (Updated 115 weeks ago)
  • [info]lind_band_guard - Linden Band Kids (Updated 118 weeks ago)
  • [info]linoleumkitsch - linoleumkitsch (Updated 118 weeks ago)
  • [info]whalelover - Whale and Walrus (Updated 119 weeks ago)
  • [info]wxpn - WXPN Listener Community (Updated 119 weeks ago)
  • [info]rum_savvy - drink up: johnny depp/firefly/etc icons (Updated 120 weeks ago)
  • [info]eikonographia - graphics by naybob (Updated 121 weeks ago)
  • [info]p_o_m - parliament of monsters (Updated 121 weeks ago)
  • [info]johnny_awards - Johnny Depp Icon Awards (Updated 123 weeks ago)
  • [info]lol_tehawesome - icons of great variety (Updated 124 weeks ago)
  • [info]depporliicons - JD//OB Icons (Updated 125 weeks ago)
  • [info]la_filmoteca - La Filmoteca (Updated 131 weeks ago)
  • [info]iconic_writings - Iconic Writings - A Writing and Graphics Challenge (Updated 137 weeks ago)
  • [info]clevermagic - Clever Magic: a panfandom community (Updated 139 weeks ago)
  • [info]secretchorus - ::secretchorus:: Icons & Etc. (Updated 139 weeks ago)
  • [info]damned_icons - damned_icons (Updated 140 weeks ago)
  • [info]xcinemamusiquex - ...Cinéma & Musique... (Updated 143 weeks ago)
  • [info]captionthispix - Caption This Picture (Updated 144 weeks ago)
  • [info]filmographics - Filmographics! (Updated 144 weeks ago)
  • [info]we_hate_duff - Hilary Duff Haters Anonymous (Updated 145 weeks ago)
  • [info]johnny_boys - johnny_boys (Updated 145 weeks ago)
  • [info]chouchou - chouchou icons (Updated 146 weeks ago)
  • [info]catture - Catture (Updated 146 weeks ago)
  • [info]thamesgothic - Community for goths and goth related events in the (Updated 146 weeks ago)
  • [info]disneymacabre - Disney's Spooky Side (Updated 148 weeks ago)
  • [info]depp_dosage - depp_dosage (Updated 151 weeks ago)
  • [info]claim_johnny - claim_johnny (Updated 153 weeks ago)
  • [info]just_a_picture - Laney and Tracy's Icon Community (Updated 155 weeks ago)
  • [info]cbw_extreme - CBW_Extreme (Updated 156 weeks ago)
  • [info]rosenrot_icons - Rosenrot Icons (Updated 157 weeks ago)
  • [info]skeleton_moon - a community for the greatest season, Autumn. (Updated 159 weeks ago)
  • [info]recommendmovies - Recommend Good Movies (Updated 160 weeks ago)
  • [info]burtononburton - A Tim Burton Community (Updated 161 weeks ago)
  • [info]_claimjohnny - _claimjohnny (Updated 166 weeks ago)
  • [info]xmyxobsessionxx - Obsession (Updated 166 weeks ago)
  • [info]poetry_4_price - A room for poets to post their own haunting tales (Updated 166 weeks ago)
  • [info]gnarly_vids - Fan Music Videos @ Gnarly Vids (Updated 167 weeks ago)
  • [info]cranesandsjack - Ichabod Crane, Sands, and Jack Sparrow (Updated 168 weeks ago)
  • [info]curiousericons - curiouser icons (Updated 169 weeks ago)
  • [info]punk_goth_loser - We are the punks, goths, freaks, nerds, and losers (Updated 169 weeks ago)
  • [info]deppislove - Depp Is Love (Updated 169 weeks ago)
  • [info]xpennedrevolt - fanfics. fanifcs. and more fanfics! (Updated 171 weeks ago)
  • [info]unsolicitedicon - Unsolicited Icons and Graphics. (Updated 172 weeks ago)
  • [info]__deppaholics - __deppaholics (Updated 173 weeks ago)
  • [info]deepindepp_fans - Johnny Depp (Updated 177 weeks ago)
  • [info]50horroricons - Blood, Fear, and the Will to Fight (Updated 180 weeks ago)
  • [info]iconxbrothel - The Icon Mistress (Updated 182 weeks ago)
  • [info]depp_challenge - depp_challenge (Updated 182 weeks ago)
  • [info]_glass_slippers - graphics community (Updated 182 weeks ago)
  • [info]shit_on_tv - shit_on_tv (Updated 184 weeks ago)
  • [info]johnny_xovers - [ Johnny Depp Crossovers ] (Updated 185 weeks ago)
  • [info]genreviews - news, reviews, and self-abuse (Updated 185 weeks ago)
  • [info]jdepplayouts - JDeppLayouts (Updated 186 weeks ago)
  • [info]do_me_wonka - Do_me_Willy Wonka (Johnny Depp as Willy Wonka) (Updated 187 weeks ago)
  • [info]depp_chorus - Depp Lyrical Icon Challenge (Updated 188 weeks ago)
  • [info]dorkylosers - dorkylosers (Updated 192 weeks ago)
  • [info]horror_fans - Horror Movie Fanatics (Updated 192 weeks ago)
  • [info]misanthr0pic - [ M i s a n t h r o p y ] (Updated 192 weeks ago)
  • [info]depp_obsession - Depp Obsession (Updated 193 weeks ago)
  • [info]chesterobsessor - _ChesterInDisguise_ (Updated 194 weeks ago)
  • [info]timsrus - Tims 'R' us (Updated 195 weeks ago)
  • [info]movie100 - obscure and popular fanfiction in 100 words (Updated 195 weeks ago)
  • [info]hereinthesearms - Right Here in my Arms (Updated 196 weeks ago)
  • [info]burtonmania - BurtonMania (Updated 196 weeks ago)
  • [info]the_lobby - Katu and Jacq's Muses (Updated 197 weeks ago)
  • [info]i_heart_jd - ♥~*I Heart Johnny Depp*~♥ (Updated 199 weeks ago)
  • [info]deppaholics - DepPaHoliCs- FOr Hardcore Johnny Depp Fans (Updated 200 weeks ago)
  • [info]90sclaims - 90's Claims (Updated 201 weeks ago)
  • [info]jdepp_fans - jdepp_fans (Updated 202 weeks ago)
  • [info]jenny_depp - so girly. so pretty. there is no WAY that's male! (Updated 202 weeks ago)
  • [info]silverxxbullets - Your my shattered mirror (Updated 202 weeks ago)
  • [info]timburton_isgod - Tim BUrton is WonderFul (Updated 203 weeks ago)
  • [info]burtonchallenge - Tim Burton Icontest (Updated 203 weeks ago)
  • [info]fairlysimple - fairlysimple (Updated 203 weeks ago)
  • [info]tburtonicontest - Tim Burton (100 x 100 Icon) Challenge (Updated 204 weeks ago)
  • [info]thexposedyou - XposeURself (Updated 206 weeks ago)
  • [info]_slice_n_dice_ - For The Real Horror Movie Fans (Updated 206 weeks ago)
  • [info]ong_mindy - ONG MINDY!11!3!6!9!12! (Updated 207 weeks ago)
  • [info]rhondastreeteam - Rhonda Street Team (Updated 207 weeks ago)
  • [info]movies100 - Movie 100 drabbles (Updated 207 weeks ago)
  • [info]hott_graphix - hott_graphix (Updated 211 weeks ago)
  • [info]grrlie_idols - Rebel Girl you are the Queen of my world! (Updated 212 weeks ago)
  • [info]allerleiicons - Allerlei Icons (Updated 212 weeks ago)
  • [info]film_seduction - Silverscreen Seduction (Updated 212 weeks ago)
  • [info]just_johnnyx - just_johnnyx (Updated 214 weeks ago)
  • [info]johnnyluvsme - Johnny Lovers (Updated 215 weeks ago)
  • [info]claim_deppitems - Claim_deppitems (Updated 215 weeks ago)
  • [info]hrrorthrillr50 - Horror and Thriller: The Dark Side of Cinema Icons (Updated 215 weeks ago)
  • [info]xxbowloforanges - Bowl Of Oranges (Updated 216 weeks ago)
  • [info]wonka_ish - Charlie & the Chocolate Factory (Updated 216 weeks ago)
  • [info]adorablepsychos - My Tortured Muses (Updated 217 weeks ago)
  • [info]suspensemovies - suspense movies (Updated 217 weeks ago)
  • [info]beautiful_eye_ - 'Your Beautiful Blue Eye' - An Icon Community (Updated 218 weeks ago)
  • [info]burt0nisgenius - Tim Burton Fans (Updated 218 weeks ago)
  • [info]omgnotugly - OMG! Not Ugly (Updated 218 weeks ago)
  • [info]icon_faery - Icon Faery (Updated 219 weeks ago)
  • [info]artists_lounge - Artist's Lounge (Updated 221 weeks ago)
  • [info]do_me_ichabod - Community for Ichabod Crane (Updated 224 weeks ago)
  • [info]chiflados_sa - La habitación acolchada (Updated 224 weeks ago)
  • [info]jdcp - Johnny Depp Chocolate Parties (Updated 224 weeks ago)
  • [info]islandey_icons - Islandey Icons! (Updated 224 weeks ago)
  • [info]hella___rad - We're Hella Rad (Updated 224 weeks ago)
  • [info]__exoticshadows - __exoticshadows (Updated 225 weeks ago)
  • [info]_darkicons - Dark Icons (Updated 225 weeks ago)
  • [info]badficsupport - Badfic Support (Updated 226 weeks ago)
  • [info]deppgirls - DeppGirls! (Updated 226 weeks ago)
  • [info]xtimxburtonx - ♥Tim Burton (Updated 227 weeks ago)
  • [info]depp_hush - A Johnny Depp Textless Icon Challenge (Updated 229 weeks ago)
  • [info]fears_ooc - Sum of all Fears OOC (Updated 232 weeks ago)
  • [info]sum_ofall_fears - Sum of all Fears (Updated 234 weeks ago)
  • [info]icons_oferised - i c o n e s s (Updated 235 weeks ago)
  • [info]xxjohnnylovexx - Johnny Depp Lovers (Updated 236 weeks ago)
  • [info]simply_batty - Simply Batty (Updated 236 weeks ago)
  • [info]jd_n_colorbars - JD_n_Colorbars (Updated 237 weeks ago)
  • [info]deppism - deppism (Updated 238 weeks ago)
  • [info]deadfest_london - London Dreams (Updated 240 weeks ago)
  • [info]haunted_designs - ...Of Melancholy Burning (Updated 243 weeks ago)
  • [info]trixen_icons - trixen_icons (Updated 243 weeks ago)
  • [info]depp_bloom - Depp_Bloom (Updated 245 weeks ago)
  • [info]timothy_burton - timothy_burton (Updated 249 weeks ago)
  • [info]do_me_johnny - Johnny Depp (Updated 250 weeks ago)
  • [info]40andlovingit - Amber (Updated 252 weeks ago)
  • [info]thisship_icons - "This Ship" Icons (Updated 253 weeks ago)
  • [info]pure_johnny - Stenchman Luver (Updated 253 weeks ago)
  • [info]depp_claims - Johnny Depp Claims (Updated 255 weeks ago)
  • [info]johnny_depp_fan - johnny_depp_fan (Updated 256 weeks ago)
  • [info]__serpensortia - (Updated 256 weeks ago)
  • [info]oppertunemoment - ...waiting for the oppertune moment... (Updated 259 weeks ago)
  • [info]sailor_usagi - The Tim Burton Community (Updated 262 weeks ago)
  • [info]depp_watch - Depp Watch (Updated 267 weeks ago)
  • [info]ricons_for_all - _random_icon_lovers_ (Updated 267 weeks ago)
  • [info]depp_dates - Depp Dates (Updated 268 weeks ago)
  • [info]_afi_imarobot_ - AFI & IMA ROBOT COMMUNITY (Updated 268 weeks ago)
  • [info]foreverjohnny - Forever Johnny (Updated 268 weeks ago)
  • [info]deppolicious - deppolicious (Updated 274 weeks ago)
  • [info]twiight_z0ne - Movie Talk (Updated 280 weeks ago)
  • [info]good_movies - the community for movies that dont suck (Updated 280 weeks ago)
  • [info]depp_rp - Depp Role Players (Updated 281 weeks ago)
  • [info]jdepp_doolally - Jdepp_doolally (Updated 281 weeks ago)
  • [info]kult_harbinger - kult_harbinger (Updated 295 weeks ago)
  • [info]we_luv_johnny - we_luv_johnny (Updated 307 weeks ago)
  • [info]gl_teaparty - gothiclolitafakehairscarymessycleavagedolls (Updated 341 weeks ago)
  • [info]admirablequeen - admirablequeen (Never updated)
  • [info]afalumniactors - Agua Fria High Alumni Actors/Thespians (Never updated)
  • [info]dearaby - aby (Never updated)
  • [info]imagine_icons_ - Imagine :: Icons (Never updated)
  • [info]lolita_kayako - Kayako (Never updated)
  • [info]morgans_crazzy - ___Eclectica___ (Never updated)
  • [info]nauticaljustice - Ad Undas (Never updated)
       Ad Undas: Icons & Graphics--POTC, Firefly, etc!
  • [info]photocall - PhotoCall (Never updated)
  • [info]shite_goth_fic - HIM and other stuff (Never updated)
  • [info]sleepyhollowfic - Sleepy Hollow Fanfiction (Never updated)
       This is a place for Sleepy Hollow fans to post their fanfiction!
  • [info]thatsdepp4ya - Who loves Johnny? We do. (Never updated)
  • [info]xschizzy24x - ChEcK_yOuR_sHoWeR (Never updated)

Results for users interested in "sleepy hollow"

More fun stuff can be found on the interests page.

375 matches:

Page 1 of 8
<< [1] [2] [3] [4] [5] [6] [7] [8] >>

heathyre userpic
[info]heathyre
Name:Heathyre
Journal:The True Lies of Heathyre Perara
Updated 35 minutes ago
dreamiflame userpic
[info]dreamiflame
Name:Meli
Journal:Wild Ramblings
Updated 4 hours ago
angrypaladin userpic
[info]angrypaladin
Name:Parker
Journal:di· verse a· la· rums and excursions
Updated 5 hours ago
ceriselle userpic
[info]ceriselle
Name:hayles
Journal:i kill myself with questions
Updated 5 hours ago
juniper200 userpic
[info]juniper200
Name:Exhausted from oversleep, awake but still in bed.
Journal:Sometimes when you make an omelet, you have to kill a few people.
Updated 7 hours ago
ajodasso userpic
[info]ajodasso
Name:The Mixed-Up Files of Adrienne J. Odasso
Journal:Lost in Transcription
Updated 7 hours ago
cupcake_goth userpic
[info]cupcake_goth
Name:And Echo replied: "Count the spoons!"
Journal:When real things happen to imaginary people
Updated 10 hours ago
gloomcookie userpic
[info]gloomcookie
Name:Gloomcookie
Journal:Hello friendo!
Updated 10 hours ago
spooky userpic
[info]spooky
Name:spooky
Updated 17 hours ago
nicenicegirl userpic
[info]nicenicegirl
Name:Kristy
Updated 20 hours ago
kiyomizu37 userpic
[info]kiyomizu37
Name:Sara
Journal:this is an insight
Updated 22 hours ago
unseelie userpic
[info]unseelie
Name:Richard's Web Persona
Journal:Random Rantings
Updated 22 hours ago
lalalalisa userpic
[info]lalalalisa
Name:Lisa Myrtice
Journal:a day in the life of crazytown.
Updated 23 hours ago
audaciously userpic
[info]audaciously
Name:Danielle
Journal:Beneath the sheets of paper lies my truth
Updated 1 day ago
auryanne userpic
[info]auryanne
Name:Auryanne
Journal:Commala-ka-kate
Updated 1 day ago
animorph userpic
[info]animorph
Name:Master of Disaster
Journal:I used to be my own protection but not now...
Updated 1 day ago
desar userpic
[info]desar
Name:Lucien Desar
Journal:The Journal Of Lucien Desar
Updated 1 day ago
teitei userpic
[info]teitei
Name:Kupi
Journal:fox in the snow
Updated 1 day ago
xenola userpic
[info]xenola
Name:La
Journal:= = =
Updated 1 day ago
shemem userpic
[info]shemem
Name:Bast's Warmth
Journal:jerry-rig my soul
Updated 1 day ago
stayja userpic
[info]stayja
Name:Another Innocent Girl
Journal:Thought she deserved no less than she'd give
Updated 1 day ago
irisbleufic userpic
[info]irisbleufic
Name:(of course i have ghosts)
Journal:If there is a way to find you, I will find you—
Updated 1 day ago
talkingpotato userpic
[info]talkingpotato
Name:Spankmonkey of the Hippies
Journal:It makes one shiver all over;
Updated 1 day ago
sensitivinferno userpic
[info]sensitivinferno
Name:The Hammer of Justice!
Journal:I Turn to You
Updated 1 day ago
yankeegreens userpic
[info]yankeegreens
Name:jenny
Journal:hey baby, i hear the blues a-callin'... tossed salad and scrambled eggs.
Updated 1 day ago
annabelevil userpic
[info]annabelevil
Name:Annabel
Journal:DJ Annabel Evil
Updated 1 day ago
teylaminh userpic
[info]teylaminh
Name:T'eyla Minh
Journal:T'eyla Minh
Updated 2 days ago
carinahead userpic
[info]carinahead
Name:Carina Crash
Journal:is there anyone else..
Updated 2 days ago
kh1369 userpic
[info]kh1369
Name:Katie
Journal:Katie's Journal
Updated 2 days ago
atomic_seamonki userpic
[info]atomic_seamonki
Name:Twilight_Fury
Journal:If you're not part of the solution,
Updated 3 days ago
debb userpic
[info]debb
Name:The Sarcastic One
Journal:Rantings of a Champion Moaner
Updated 3 days ago
odubtaig userpic
[info]odubtaig
Name:O'Dubtaig: Inter-Regional Man of Mystery
Updated 3 days ago
angelys userpic
[info]angelys
Name:LydiaPandora
Journal:LydiaPandora
Updated 3 days ago
unhappyending userpic
[info]unhappyending
Name:Phaedra
Journal:an unhappyending
Updated 4 days ago
mickr userpic
[info]mickr
Name:The Yorkshire Leprechaun
Journal:Growing old is compulsory -
Updated 4 days ago
fraught userpic
[info]fraught
Name:post-apocalyptic supernatural pharaoh
Updated 4 days ago
paintedponyxox userpic
[info]paintedponyxox
Name:Sara
Journal:通常在妇女佩带的复数内裤
Updated 5 days ago
igaboo userpic
[info]igaboo
Name:*Crazy Lady*
Journal:Crazy Lady
Updated 5 days ago
flamingheart71 userpic
[info]flamingheart71
Name:Crystal
Journal:.Eternal Energy .( *
Updated 1 week ago
magenta_girl userpic
[info]magenta_girl
Name:magenta girl
Journal:And Baby Makes Six...
Updated 1 week ago
puremalevolence userpic
[info]puremalevolence
Name:Lady Jacqula, Mistress of the Dark
Journal:Some are born to sweet delight...
Updated 1 week ago
missus_paul userpic
[info]missus_paul
Name:Carmen
Journal:Journal Contents
Updated 1 week ago
drunkencarousal userpic
[info]drunkencarousal
Name:lazy snake
Journal:the great shipwreck of life
Updated 1 week ago
reah userpic
[info]reah
Name:reah
Journal:The Angel With Broken Wings
Updated 1 week ago
theorangechick userpic
[info]theorangechick
Name:Mychelle
Journal:Jynx
Updated 1 week ago
kayshee userpic
[info]kayshee
Name:Danielle
Journal:welcome to strange land.
Updated 1 week ago
kurai_hime userpic
[info]kurai_hime
Name:Iris-Juylyenne
Journal:ヤェーパンダ！
Updated 1 week ago
wizardgurl userpic
[info]wizardgurl
Name:and the wind cried Mary
Journal:I'll be the phonograph that plays your favorite albums back
Updated 1 week ago
lonelynfading userpic
[info]lonelynfading
Name:Living a Bohemian lifestyle
Journal:The Space between Dreaming and Reality
Updated 1 week ago
gypsysp userpic
[info]gypsysp
Name:gypsysp
Journal:...
Updated 1 week ago
 
 
Create an Account
Forgot your login or password?
Login w/ OpenID
English • Español • Deutsch • Русский…