?

Log in

Interests

Try searching posts and comments with the new LiveJournal text search

Find people and communities interested in:
 
Modify your interests based on those of:
 
 

Results for communities interested in "sleepy hollow"

311 matches:

  • het_reccers - Multifandom Het Fanfiction Recs (Updated 2 hours ago)
       A community for recommending het fanfic from just about any fandom under the sun.
  • screencapped - Screencapped.net - A HQ Screencap Archive (Updated 8 hours ago)
       A high quality screencap archive for movies and tv shows
  • sweeping_epics - Lovers of period films (Updated 13 hours ago)
  • movie_freaks - Addicted to Movies (Updated 14 hours ago)
  • capspiration - CAPSPIRATION (Updated 15 hours ago)
  • tvshowsic - TV Shows Icon Community (Updated 16 hours ago)
       Icon Challenge Community
  • iimpossibletask - iimpossibletask (Updated 22 hours ago)
  • 2thousand3 - 2thousand3; icons/graphics (Updated 1 day ago)
  • period_drama - Period Drama Graphics (Updated 3 days ago)
  • fanfic50 - fanfic50 (Updated 2 weeks ago)
       50 pieces of fic/fanart
  • horror_movies - Horror Movies (Updated 2 weeks ago)
  • mundodefieras - shameless666's icon journal (Updated 2 weeks ago)
  • newbieguide - The Newbie's Guide to Fannish LiveJournal (Updated 3 weeks ago)
  • iwillnotdance - I will not dance (Updated 1 month ago)
  • costume_icons - Sweetness (Updated 2 months ago)
       Icon Comunity for Movie/Theatre Costume related icons!
  • tim_burton_ru - Tim Burton по-русски (Updated 2 months ago)
  • horroricons - Horror Icons (Updated 4 months ago)
       Graphics related to horror movies, games, books, comics etc.
  • johnny_icons - Shame About Raisins (Updated 5 months ago)
  • johnny_depp - Fans of Johnny Depp (Updated 5 months ago)
  • jdepp_lovers - For all Johnny Depp Lovers out there (Updated 5 months ago)
       This community is abt anything related to Johnny Depp. Feel Free To Share Ur Graphics Here.
  • deppicons - Deppicons (Updated 5 months ago)
  • depp_graphics - Johnny Depp graphics (Updated 5 months ago)
  • isapiens - icons by hsapiens (Updated 6 months ago)
       Icons by hsapiens
  • brizzo - God Child Diary - for cain and Kaori Yuki fans! (Updated 8 months ago)
  • haunted_designs - ...Of Melancholy Burning (Updated 8 months ago)
  • just_johnnyx - just_johnnyx (Updated 8 months ago)
  • widdershins - Geek Mythologies (Updated 9 months ago)
       an icon community with an identity crisis.
  • fandom_obsessed - .:: An Obsessive Icon Journal ::. (Updated 10 months ago)
  • otherworldlyric - Otherworldlyrics Icon Contest (Updated 10 months ago)
       Lyrical prompts
  • ichabbie - Sleepy Hollow's Ichabod and Abbie Shipping Comm (Updated 10 months ago)
       Shipping for Ichabod and Abbie
  • sleepy_hollow - Sleepy Hollow (Updated 10 months ago)
  • johnnyd_icons - johnnyd_icons (Updated 11 months ago)
  • all_hallows - This is Halloween 2009! (Updated 11 months ago)
       A year-round celebration of Halloween.
  • argentum_alley - La comunidad de las elejoteras argentinas (Updated 11 months ago)
  • photo_11 - photo_11 (Updated 12 months ago)
  • dark_artt - Dark Artt (Updated 1 year ago)
  • vidding_archive - Lost Library of the Vidders (Updated 1 year ago)
  • burton_icons - Tim Burton Icons (Updated 1 year ago)
  • souless_village - Area 51 (Updated 1 year ago)
  • halloweenasylum - Crazy About Halloween? (Updated 1 year ago)
       Crazy about Halloween? Come join us!
  • rhythminrain - Icons by wonderishere (Updated 1 year ago)
  • timey_jiggery - Timey Jiggery (Updated 1 year ago)
  • the_tangle_box - The Tangle Box (Updated 2 years ago)
  • candycorncomm - Halloween Candy (Updated 2 years ago)
       a year-round community for spooky, silly, and scary movies
  • teamhorsemen - Team Horsemen (of Sleepy Hollow Land) (Updated 2 years ago)
  • rocklogic - rocklogic (Updated 2 years ago)
       icons & etc by wickdshy
  • teamwitnesses - Team Witnesses (of Sleepy Hollow Land) (Updated 2 years ago)
  • sleepyhollowlnd - Sleepy Hollow Land (a land comm for FOX's new hit (Updated 2 years ago)
  • sh_itest - Sleepy Hollow Weekly Icon Contest (Updated 2 years ago)
  • arsenicfashions - Arsenic Fashions (Updated 2 years ago)
  • storybookland - The Art of children's books, fairy tales, & fables (Updated 2 years ago)
       Art of Children's Stories
  • horrorfiends - Community for Fans of everything H O R R O R (Updated 2 years ago)
  • _thehorror - CLASSIC HORROR FILMS (Updated 3 years ago)
  • kalao - Kalao (Updated 3 years ago)
  • asiangoths - Asian Goths (Updated 3 years ago)
       Goth culture for the East
  • _depp - The Lovers of Johnny Depp (Updated 3 years ago)
  • christo4walken - christo4walken (Updated 3 years ago)
  • spookystyle - The Spooky Style Guide (Updated 3 years ago)
  • timburton - The first (and best!) Tim Burton Community (Updated 3 years ago)
       Tim Burton
  • still_epics - EPICS: ICONED. (Updated 3 years ago)
       multi-fandom icontest
  • westchester - westchester (Updated 3 years ago)
  • realmofsilence - Graphics by theriakx (Updated 3 years ago)
  • jiiive - icon community ran by boredess (Updated 3 years ago)
       random icons that will interest you!
  • home_scary_home - Home Scary Home (Updated 3 years ago)
       Scary Homes
  • horror_writing - Horror Writing (Updated 3 years ago)
  • thdarkarts - The Dark Arts (Updated 3 years ago)
  • panniers - liaisons dangereuses (Updated 4 years ago)
  • misfits_inc - misfits (Updated 4 years ago)
  • timburton_icons - Tim Burton Icons (Updated 4 years ago)
  • deppstills - Depp Stills - a Johnny Depp icontest (Updated 4 years ago)
       A Johnny Depp icontest
  • excellentnotion - excellent notion graphics (Updated 4 years ago)
  • therosebower - the rose bower (Updated 4 years ago)
  • fantasycostume - Fantasy Costume (Updated 4 years ago)
  • victorianera - Lovers of Victoriana with a Futuristic Edge (Updated 4 years ago)
       I guess this was/is a proto-Steampunk group? Treat it as that, but join up, join up!
  • tbcollective - Collective Boogaloo (Updated 4 years ago)
  • itsuncanny - It's Uncanny! - A Tim Burton Community (Updated 4 years ago)
  • maiconography - maiconography - etilia76's graphic journal (Updated 4 years ago)
  • burton_beauties - Burton Beauties (Updated 4 years ago)
       A Tim Burton Stamping Community
  • horror_films - 6 6 6 (Updated 4 years ago)
  • solnacist - Snapshots- A Multifandom Reccing Journal (Updated 4 years ago)
       reccing, fandoms
  • mysticalicons - mysticalicons: too good to be true (Updated 4 years ago)
       ...graphix by iluvpoto...
  • nightshade_rate - Which Burton babe are you? (Updated 4 years ago)
  • best_browneyes - Brown Eyes (Updated 4 years ago)
  • chesterobsessor - _ChesterInDisguise_ (Updated 4 years ago)
  • burtondepp - Burton/Depp (Updated 4 years ago)
       Community for the fans of collaborations of Tim Burton and Johnny Depp.
  • tikketyboo - graphics by naybob (Updated 4 years ago)
  • jdeppicons - Johnny Depp Icons (Updated 4 years ago)
  • amoriconz - icons & banners of my favorite things... (Updated 4 years ago)
  • horror_vids - Horror fan videos (Updated 4 years ago)
  • kitd_recs - Kittens in the Dark - Recs! (Updated 4 years ago)
  • christopherlee_ - Christopher Lee fans (Updated 5 years ago)
       A place for Christopher Lee fans to discuss his acting career and screen appearances.
  • wxpn - WXPN Listener Community (Updated 5 years ago)
  • loserlykid - LoserlyLuv (Updated 5 years ago)
  • icon_spengler - Spengler Labs (Updated 5 years ago)
       kremlindusk's meager icon & graphics journal of various fandoms and miscellany.
  • _suicidekitten_ - Art of Karla Ruiz - SuicideKitten Icons (Updated 5 years ago)
  • halloween_town - THE ORIGINAL N.B.C. COMMUNITY. (Updated 5 years ago)
  • flackmistress - icons and graphics; by lerdumcyllus (Updated 5 years ago)
  • love_square - Love Square (Updated 5 years ago)
  • scarlet_designs - scarlet designs (Updated 5 years ago)
  • closetgoths - closet goths (Updated 5 years ago)
  • belleslibrary - Belle's Library (Updated 5 years ago)
  • graphics_narnia - Narnia Graphics (Updated 5 years ago)
  • dannyelfmanfans - + THE DANNY ELFMAN COMMUNITY + (Updated 5 years ago)
  • all_japanese - For all who love japanese (Updated 5 years ago)
  • factory_icons - Icons Factory (Updated 5 years ago)
       icons community
  • _wishbone - Wishbone (Updated 5 years ago)
  • deppophiliacs - Deppophiliacs: A community devoted to Johnny Depp. (Updated 5 years ago)
  • ricci_icons - riccicons {} (Updated 5 years ago)
  • ricci_hardcore - Christina Ricci Crush Community (Updated 5 years ago)
  • miranda_fans - Miranda Richardson Fans (Updated 5 years ago)
  • captionthispix - Caption This Picture (Updated 5 years ago)
  • funeral_home - Everything Beautiful Dies (Updated 5 years ago)
  • thexposedyou - XposeURself (Updated 5 years ago)
  • hexxt - ::HeXxt:: (Updated 5 years ago)
  • loserlyluv - Loserly kid (Updated 5 years ago)
  • _slice_n_dice_ - For The Real Horror Movie Fans (Updated 5 years ago)
  • trappedhere - Trapped Here... (Updated 6 years ago)
  • tim_tams - A Tim burton community...please join (Updated 6 years ago)
  • _timburtonxcore - Tim burton movie fans (Updated 6 years ago)
  • do_me_wonka - Do_me_Willy Wonka (Johnny Depp as Willy Wonka) (Updated 6 years ago)
  • do_me_victor - Corpse Bride #1 and First Fan Site! Honestly! (Updated 6 years ago)
  • do_me_ichabod - Community for Ichabod Crane (Updated 6 years ago)
  • 50horroricons - Blood, Fear, and the Will to Fight (Updated 6 years ago)
  • bluelake - Blue Lake Fine Arts Camp (Updated 6 years ago)
  • __just_graphics - Just x Graphics (Updated 6 years ago)
  • johhnydepp - Johnny Depp Fans (Updated 6 years ago)
  • depp_fans - Johnny Depp Fans (Updated 6 years ago)
  • lind_band_guard - Linden Band Kids (Updated 6 years ago)
  • hereinthesearms - Right Here in my Arms (Updated 6 years ago)
  • _corpsebride_ - Your 1st Official Corpse Bride Community (Updated 6 years ago)
  • _claimjohnny - _claimjohnny (Updated 6 years ago)
  • clevermagic - Clever Magic: a panfandom community (Updated 6 years ago)
  • __deppaholics - __deppaholics (Updated 6 years ago)
  • bobs_shadow - триллеры и фильмы ужасов (рецензии и анонсы) (Updated 6 years ago)
  • faraway_land - Folklore & Fairy Tale Fans (Updated 6 years ago)
  • riccicons - Christina Ricci Icons (Updated 6 years ago)
  • fears_ooc - Sum of all Fears OOC (Updated 6 years ago)
  • timsrus - Tims 'R' us (Updated 6 years ago)
  • shit_on_tv - shit_on_tv (Updated 6 years ago)
  • film_fan - The film review community. (Updated 6 years ago)
  • p_o_m - parliament of monsters (Updated 6 years ago)
  • depp_fanart - Johnny Depp Fan Art (Updated 6 years ago)
  • darklinksnews - Dark Side of the Net (Updated 6 years ago)
       Darklinks.com goth, Halloween, horror and industrial links
  • depp_elite - DEPP ELITE; (Updated 6 years ago)
       the elite johnny depp icon community.
  • __serpensortia - (Updated 6 years ago)
  • ricci_world - CHRISTINA RICCI WORLD. (Updated 6 years ago)
  • johnnyfanfic - Johnny Depp Fanfic (Updated 6 years ago)
  • johnnyrocks - Johnny Depp (Updated 6 years ago)
  • xxxdeppxxx - Johnny Depp Lovers (Updated 6 years ago)
  • deppanonymous - Depp Anonymous, for all types of fans (Updated 6 years ago)
  • johnny_daily - Johnny Depp Daily (Updated 6 years ago)
  • blackdossier - Musebox (Updated 6 years ago)
       Call it a "Musecloset."
  • jaynasicons - Simple and Clean Icons (Updated 6 years ago)
  • midnitesociety - The Midnite Society (Updated 6 years ago)
  • jdepplayouts - JDeppLayouts (Updated 6 years ago)
  • bloomndepp - ♥ Bloom n Depp ♥ (Updated 6 years ago)
  • mango_icons - mangofandango's icons (Updated 6 years ago)
  • girlfridayicons - girlfridayicons (Updated 6 years ago)
       costume drama icons
  • johnnydeppfans - For all those Johnny Depp fans out there... (Updated 6 years ago)
  • depplove - johnny depp love (Updated 6 years ago)
  • ___timburton - Tim Burton Fans (Updated 6 years ago)
  • silencexile - Silence Exile Cunning (Updated 6 years ago)
       Johnny Depp, a great Actor, Director and Humanitarian.
  • prombound - Prometheus Bound (Updated 7 years ago)
       Brisbane's Premiere Steampunk Event
  • mervin_graphics - Mervin's Graphics (Updated 7 years ago)
  • tick_icon - Icons by tick_ (Updated 7 years ago)
  • realitys_edge - Reality's Edge (Updated 7 years ago)
  • johnnydose - A daily dose of delicious Johnny D. (Updated 7 years ago)
  • johnnydepprules - Johnny Depp and POTC Fans (Updated 7 years ago)
  • leia06graphixs - My Artistic Domain (Updated 7 years ago)
  • fantasy_contest - Magical Icon Challenges (Updated 7 years ago)
  • movieobsessed - MovieManMenzel's MovieLand Mania (Updated 7 years ago)
  • johnnydeppfan - Johnny Depp Fan (Updated 7 years ago)
  • cute_n_evil - cuteandevilclothing (Updated 7 years ago)
  • johnnydeppluv - Johnny Depp Luv (Updated 7 years ago)
  • johnnylovers - johnnylovers (Updated 7 years ago)
  • johnnydeppfan1 - Johnny Depp Fans (Updated 7 years ago)
  • saltyaria - saltyaria graphics (Updated 7 years ago)
  • elfmanesque - Music For a Darkened Theater (Updated 7 years ago)
  • johnnymovieicon - Johnny Depp Movie Icons (Updated 7 years ago)
  • depp_stillness - Johnny Depp Stillness (Updated 7 years ago)
  • ichabod_depp - For fans of Johnny Depp's ICHABOD CRANE character (Updated 7 years ago)
  • ____gunxbang - _ _ _ _gunxbang (Updated 7 years ago)
  • _lifelessness_ - Lifeless Fools (Updated 7 years ago)
  • _welove90 - 1990 - 1999 (Updated 7 years ago)
  • erikagiry_icons - Erika Giry Icons (Updated 7 years ago)
  • tick_caps - Caps by tick_ (Updated 7 years ago)
  • lovettdream - .::lovett dream::. (Updated 7 years ago)
       where all your dreams come true!
  • barking_irons - For all things Barking Irons (Updated 8 years ago)
       Anything Barking Irons
  • thrill_icons - THRILL ICONS (Updated 8 years ago)
  • _magickalicons_ - *~*The Magick Shoppe*~* (Updated 8 years ago)
  • starsfellondepp - Oh, Johnny! (Updated 8 years ago)
  • o_d_d - Obsessive-DiCaprio/Depp-Disorder (Updated 8 years ago)
  • movie_nazis - Movie Nazis (Updated 8 years ago)
  • depp_domain - Depp_Domain (Updated 8 years ago)
  • lovedepp - Фан-клуб Джонни Деппа (Updated 8 years ago)
  • beneath_thesong - * A New color to paint the World * (Updated 8 years ago)
  • geelongfc - Geelong Football Club (Updated 8 years ago)
  • morbidwednesday - Morbid Wednesdays - A Christina Ricci Community (Updated 8 years ago)
  • ffabcentral - Fanfiction Association of Britain (Updated 8 years ago)
  • dannyfic - The Danny Elfman Fanfiction Community (Updated 8 years ago)
  • homology_cubed - Fanfiction Recs for All (Updated 8 years ago)
  • bewitched_me - A Sleepy Hollow- Ichabod/Katrina Shipper Comm (Updated 8 years ago)
  • scary_style - Horror Homes. (Updated 8 years ago)
       Halloween & Horror Decorated Homes.
  • aoi_screenshots - aoi_screenshots (Updated 8 years ago)
  • jd_phonebook - Phonebook (Updated 9 years ago)
       A movie that Johnny Depp should star in where he will read a phonebook, eat chinese and other things
  • lonely_kids - Love Makin' Friends (Updated 9 years ago)
  • oingoboingofans - Oingo Boingo: Fans on LJ! (Updated 9 years ago)
  • nightmare_ru - The Nghtmare Before Christmas (Updated 9 years ago)
  • deppfanfiction - Depp Fanfiction (Updated 9 years ago)
  • _cillianmurphy_ - Everything Cillian Murphy Everyday (Updated 9 years ago)
  • filmbooksmusic - Recommend your favorite movies, books and music (Updated 9 years ago)
  • gore_x_whores - Gore_x_Whores & Scream_x_Queens...Rate Us... (Updated 9 years ago)
  • blauebananen - Blaue Bananen (Updated 9 years ago)
       Filmkritiken
  • johnny_freaks - johnny_freaks (Updated 9 years ago)
  • burton_stills - Icon Challenge for Tim Burton Films (Updated 9 years ago)
  • exorcist_fans - Captain Howdy Loves Reagan (Updated 9 years ago)
  • ch_arts - Lost Highway [[Challenges]] (Updated 9 years ago)
  • cocklove - Cock <3 (Updated 9 years ago)
  • johnnydepp_hush - Johnny Depp Hush (Updated 9 years ago)
  • linoleumkitsch - linoleumkitsch (Updated 9 years ago)
  • whalelover - Whale and Walrus (Updated 9 years ago)
  • rum_savvy - drink up: johnny depp/firefly/etc icons (Updated 9 years ago)
  • eikonographia - graphics by naybob (Updated 9 years ago)
  • johnny_awards - Johnny Depp Icon Awards (Updated 9 years ago)
  • lol_tehawesome - icons of great variety (Updated 9 years ago)
  • depporliicons - JD//OB Icons (Updated 9 years ago)
  • iconic_writings - Iconic Writings - A Writing and Graphics Challenge (Updated 9 years ago)
  • secretchorus - ::secretchorus:: Icons & Etc. (Updated 9 years ago)
  • damned_icons - damned_icons (Updated 9 years ago)
  • xcinemamusiquex - ...Cinéma & Musique... (Updated 10 years ago)
  • filmographics - Filmographics! (Updated 10 years ago)
  • we_hate_duff - Hilary Duff Haters Anonymous (Updated 10 years ago)
  • chouchou - chouchou icons (Updated 10 years ago)
  • disneymacabre - Disney's Spooky Side (Updated 10 years ago)
  • depp_dosage - depp_dosage (Updated 10 years ago)
  • claim_johnny - claim_johnny (Updated 10 years ago)
  • just_a_picture - Laney and Tracy's Icon Community (Updated 10 years ago)
  • cbw_extreme - CBW_Extreme (Updated 10 years ago)
  • skeleton_moon - a community for the greatest season, Autumn. (Updated 10 years ago)
  • recommendmovies - Recommend Good Movies (Updated 10 years ago)
  • burtononburton - A Tim Burton Community (Updated 10 years ago)
  • xmyxobsessionxx - Obsession (Updated 10 years ago)
  • poetry_4_price - A room for poets to post their own haunting tales (Updated 10 years ago)
  • cranesandsjack - Ichabod Crane, Sands, and Jack Sparrow (Updated 10 years ago)
  • curiousericons - curiouser icons (Updated 10 years ago)
  • deppislove - Depp Is Love (Updated 10 years ago)
  • xpennedrevolt - fanfics. fanifcs. and more fanfics! (Updated 10 years ago)
  • unsolicitedicon - Unsolicited Icons and Graphics. (Updated 10 years ago)
  • iconxbrothel - The Icon Mistress (Updated 10 years ago)
  • depp_challenge - depp_challenge (Updated 10 years ago)
  • _glass_slippers - graphics community (Updated 10 years ago)
  • genreviews - news, reviews, and self-abuse (Updated 10 years ago)
  • depp_chorus - Depp Lyrical Icon Challenge (Updated 10 years ago)
  • dorkylosers - dorkylosers (Updated 10 years ago)
  • horror_fans - Horror Movie Fanatics (Updated 10 years ago)
  • misanthr0pic - [ M i s a n t h r o p y ] (Updated 10 years ago)
  • movie100 - obscure and popular fanfiction in 100 words (Updated 11 years ago)
  • burtonmania - BurtonMania (Updated 11 years ago)
  • the_lobby - Katu and Jacq's Muses (Updated 11 years ago)
  • i_heart_jd - ♥~*I Heart Johnny Depp*~♥ (Updated 11 years ago)
  • deppaholics - DepPaHoliCs- FOr Hardcore Johnny Depp Fans (Updated 11 years ago)
  • 90sclaims - 90's Claims (Updated 11 years ago)
  • jdepp_fans - jdepp_fans (Updated 11 years ago)
  • jenny_depp - so girly. so pretty. there is no WAY that's male! (Updated 11 years ago)
  • silverxxbullets - Your my shattered mirror (Updated 11 years ago)
  • timburton_isgod - Tim BUrton is WonderFul (Updated 11 years ago)
  • burtonchallenge - Tim Burton Icontest (Updated 11 years ago)
  • fairlysimple - fairlysimple (Updated 11 years ago)
  • tburtonicontest - Tim Burton (100 x 100 Icon) Challenge (Updated 11 years ago)
  • ong_mindy - ONG MINDY!11!3!6!9!12! (Updated 11 years ago)
  • rhondastreeteam - Rhonda Street Team (Updated 11 years ago)
  • hott_graphix - hott_graphix (Updated 11 years ago)
  • grrlie_idols - Rebel Girl you are the Queen of my world! (Updated 11 years ago)
  • allerleiicons - Allerlei Icons (Updated 11 years ago)
  • johnnyluvsme - Johnny Lovers (Updated 11 years ago)
  • claim_deppitems - Claim_deppitems (Updated 11 years ago)
  • xxbowloforanges - Bowl Of Oranges (Updated 11 years ago)
  • wonka_ish - Charlie & the Chocolate Factory (Updated 11 years ago)
  • beautiful_eye_ - 'Your Beautiful Blue Eye' - An Icon Community (Updated 11 years ago)
  • burt0nisgenius - Tim Burton Fans (Updated 11 years ago)
  • omgnotugly - OMG! Not Ugly (Updated 11 years ago)
  • icon_faery - Icon Faery (Updated 11 years ago)
  • artists_lounge - Artist's Lounge (Updated 11 years ago)
  • chiflados_sa - La habitación acolchada (Updated 11 years ago)
  • islandey_icons - Islandey Icons! (Updated 11 years ago)
  • __exoticshadows - __exoticshadows (Updated 11 years ago)
  • _darkicons - Dark Icons (Updated 11 years ago)
  • badficsupport - Badfic Support (Updated 11 years ago)
  • deppgirls - DeppGirls! (Updated 11 years ago)
  • xtimxburtonx - ♥Tim Burton (Updated 11 years ago)
  • depp_hush - A Johnny Depp Textless Icon Challenge (Updated 11 years ago)
  • sum_ofall_fears - Sum of all Fears (Updated 11 years ago)
  • icons_oferised - i c o n e s s (Updated 11 years ago)
  • xxjohnnylovexx - Johnny Depp Lovers (Updated 11 years ago)
  • simply_batty - Simply Batty (Updated 11 years ago)
  • deppism - deppism (Updated 11 years ago)
  • trixen_icons - trixen_icons (Updated 11 years ago)
  • depp_bloom - Depp_Bloom (Updated 11 years ago)
  • timothy_burton - timothy_burton (Updated 12 years ago)
  • do_me_johnny - Johnny Depp (Updated 12 years ago)
  • 40andlovingit - Amber (Updated 12 years ago)
  • thisship_icons - "This Ship" Icons (Updated 12 years ago)
  • pure_johnny - Stenchman Luver (Updated 12 years ago)
  • depp_claims - Johnny Depp Claims (Updated 12 years ago)
  • johnny_depp_fan - johnny_depp_fan (Updated 12 years ago)
  • sailor_usagi - The Tim Burton Community (Updated 12 years ago)
  • depp_watch - Depp Watch (Updated 12 years ago)
  • ricons_for_all - _random_icon_lovers_ (Updated 12 years ago)
  • depp_dates - Depp Dates (Updated 12 years ago)
  • foreverjohnny - Forever Johnny (Updated 12 years ago)
  • gl_teaparty - gothiclolitafakehairscarymessycleavagedolls (Updated 13 years ago)

Results for users interested in "sleepy hollow"

More fun stuff can be found on the interests page.

358 matches:

Previous
← Ctrl ← Alt
Next
Ctrl → Alt →

kh1369 userpic
kh1369
Name:Katie
Journal:Katie's Journal
Updated 3 hours ago
talkingpotato userpic
talkingpotato
Name:Spankmonkey of the Hippies
Journal:It makes one shiver all over;
Updated 14 hours ago
magenta_girl userpic
magenta_girl
Name:magenta girl
Journal:What was I thinking?
Updated 22 hours ago
sensitivinferno userpic
sensitivinferno
Name:Cristi
Journal:I'm Meaner Than My Demons
Updated 23 hours ago
heresluck userpic
heresluck
Name:here's luck
Journal:here's luck
Updated 1 day ago
ajodasso userpic
ajodasso
Name:A.J. Odasso
Journal:Seer of ghosts & weaver of stories
Updated 2 days ago
shannonbobannon userpic
shannonbobannon
Name:Shannon
Journal:DILLIGAF?
Updated 3 days ago
mokie userpic
mokie
Name:mokie
Journal:life in mokievision
Updated 5 days ago
thormonger userpic
thormonger
Name:THORmonger
Journal:THORmonger
Updated 2 weeks ago
miseryhood userpic
miseryhood
Name:Kelly
Journal:I think I'm losing my mind now, It's in my head, darling, I hope
Updated 3 weeks ago
irisbleufic userpic
irisbleufic
Name:(lives between pages)
Journal:if there's a place for [us] that love has kept protected
Updated 3 weeks ago
mistress_sy userpic
mistress_sy
Name:Syana
Journal:The Insanity of the Owners of DLK
Updated 1 month ago
teylaminh userpic
teylaminh
Name:T'eyla Minh
Journal:T'eyla Minh
Updated 1 month ago
chyldone userpic
chyldone
Name:CDC
Journal: I believe whatever doesn't kill you simply makes you... stranger
Updated 1 month ago
wikkidgothbabe userpic
wikkidgothbabe
Name:wikkidgothbabe
Journal:The Angels have taken the LJ!!!
Updated 4 months ago
lanning userpic
lanning
Name:Lanning
Journal:uffish thought
Updated 5 months ago
dreamiflame userpic
dreamiflame
Name:Meli
Journal:Wild Ramblings
Updated 8 months ago
thecure4ca userpic
thecure4ca
Name:Peter Gibbons
Journal:MUCH I DO TO DO NOTHING
Updated 9 months ago
no default userpic
bettybubblegum
Name:i'm not really a waitress
Journal:take a sad song and make it better
Updated 12 months ago
bettiemorbid userpic
bettiemorbid
Name:BettieMorbid
Journal:Now all my nightmares know my name.
Updated 1 year ago
debb userpic
debb
Name:The Sarcastic One
Journal:Rantings of a Champion Moaner
Updated 1 year ago
reah userpic
reah
Name:reah
Journal:The Angel With Broken Wings
Updated 1 year ago
missus_paul userpic
missus_paul
Name:Carmen
Journal:Journal Contents
Updated 1 year ago
nightgoddess56 userpic
nightgoddess56
Name:NightGoddess
Journal:I'm Free & Freedom Is Power
Updated 1 year ago
lalalalisa userpic
lalalalisa
Name:Lisa Myrtice
Journal:a day in the life of crazytown.
Updated 1 year ago
xrogue81 userpic
xrogue81
Name:Roguester
Journal:Roguester's Joint
Updated 1 year ago
silverjedi331 userpic
silverjedi331
Name:~*i*am*poison*crazy*lush*~
Journal:Only now, at the end, do you understand
Updated 1 year ago
animorph userpic
animorph
Name:Master of Disaster
Journal:I used to be my own protection but not now...
Updated 1 year ago
dragon_moon userpic
dragon_moon
Name:daydreams & scribbles
Journal:Orbit Around the Dragon Moon
Updated 1 year ago
jessikah userpic
jessikah
Name:Jessikah
Journal:Longing whispers through the cable connection
Updated 2 years ago
ceriselle userpic
ceriselle
Name:hayles
Journal:i kill myself with questions
Updated 2 years ago
dragonsinger userpic
dragonsinger
Name:Dragonsinger
Journal:Tales of a Librarian
Updated 2 years ago
abandonada userpic
abandonada
Name:Abandonada
Updated 2 years ago
no default userpic
ambermoon
Name:Erin Danielle
Journal:Randomity Strikes
Updated 2 years ago
wizardgurl userpic
wizardgurl
Name:and the wind cried Mary
Journal:I'll be the phonograph that plays your favorite albums back
Updated 2 years ago
trowa userpic
trowa
Name:Trowa Barton
Journal:Torowa Ilgi
Updated 2 years ago
chibi_goth userpic
chibi_goth
Name:THE INFAMOUS CHIBI
Updated 2 years ago
brotherless_one userpic
brotherless_one
Name:George L. Stewart
Journal:"Orbis non sufficit"
Updated 2 years ago
sevensomething userpic
sevensomething
Name:Thumbie, the littlest horse
Updated 2 years ago
kerberos_3 userpic
kerberos_3
Name:Kitty Wench
Updated 2 years ago
lauchlen userpic
lauchlen
Name:on holiday
Journal:soul searching
Updated 2 years ago
odubtaig userpic
odubtaig
Name:O'Dubtaig: Inter-Regional Man of Mystery
Updated 2 years ago
bellwitch userpic
bellwitch
Name:THE DOLL MISTRESS
Journal:Doll Of Death!
Updated 3 years ago
opheliarose userpic
opheliarose
Name:I don't believe in romeos and heroes anymore
Journal:sometimes I can't believe it
Updated 3 years ago
oonak userpic
oonak
Name:almost a perfectionist
Journal:autumn breeze
Updated 3 years ago
nocturnalmyrtle userpic
nocturnalmyrtle
Name:Evil Duckie
Journal:I Really Need a Life
Updated 3 years ago
xenola userpic
xenola
Name:La
Journal:= = =
Updated 3 years ago
azn_msg userpic
azn_msg
Name:Fille introvertie
Journal:Jeune Fille Introvertie
Updated 3 years ago
crystalkittycat userpic
crystalkittycat
Name:Kitty
Journal:Kitty's Randomness and Insanity
Updated 3 years ago
malloryknox userpic
malloryknox
Name:~.f.o.o.t.s.t.e.p.s.~
Journal:Little Trouble Grrrl
Updated 3 years ago